Anti-p19ARF Rat Monoclonal Antibody (DyLight 650) [clone: 5-C3-1]
Supplier: Novus Biologicals
The p19ARF Antibody (5-C3-1) [DyLight 650] from Novus Biologicals is a rat monoclonal antibody to p19ARF. This antibody reacts with human, mouse, golden syrian hamster (negative). The p19ARF Antibody (5-C3-1) [DyLight 650] has been validated for the following applications: Western Blot, Flow Cytometry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Expand 1 Items
Nanodisc MSP1E3D1-His POPC Biotinyl PE
Supplier: CUBE BIOTECH
This product is a pre-assembled nanodisc. Its intended purpose is to stabilize a cell-free expressed membrane protein.
Expand 1 Items
Human Recombinant FGL1 (Prokaryotic) (from E. coli)
Supplier: CLOUD-CLONE CORP MS
This is a FGL1 recombinant protein (prokaryotic), Human is sequencing from Leu23~Ile312 with 90 - 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.
Expand 1 Items
Human Recombinant PSAP (Prokaryotic) (from E. coli)
Supplier: CLOUD-CLONE CORP MS
This is a PSAP recombinant protein (prokaryotic), Human is sequencing from Gly17~Asn524 with 97 - 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.
Expand 1 Items
Human hBD-1
Supplier: Anaspec Inc
Defensins are small cysteine-rich cationic proteins found in both vertebrates and invertebrates. They have host defense properties, and are active against bacteria, fungi and many viruses. Beta-defensins are the most widely distributed, being secreted by leukocytes and epithelial cells of many kinds
Sequence:DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
(Disulfide bridge: 5-34, 12-27, 17-35)
MW:3929.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
SensoLyte® HAT (p300) Assay Kit (Fluorimetric), AnaSpec Inc.
Supplier: Anaspec Inc
Histone acetyltransferases (HATs) enzymes regulate the acetylation of histones and non-histone proteins
Expand 1 Items
Anti-TH Rabbit Polyclonal Antibody
Supplier: CLOUD-CLONE CORP MS
Polyclonal Antibody to Tyrosine Hydroxylase (TH), derived from recombinant TH (Phe34~Leu301), is reactive with Mouse/Rat.
Expand 1 Items
Anti-APOC1 Mouse Monoclonal Antibody [clone: C3]
Supplier: CLOUD-CLONE CORP MS
Monoclonal Antibody to Apolipoprotein C1 (APOC1), derived from recombinant APOC1 (Gly32~Ser88), is reactive with Mouse.
Expand 1 Items
Anti-TLR6 Mouse Monoclonal Antibody (DyLight 550) [clone: 86B1153.2]
Supplier: Novus Biologicals
The TLR6 Antibody (86B1153.2) [DyLight 550] from Novus Biologicals is a mouse monoclonal antibody to TLR6. This antibody reacts with human. The TLR6 Antibody (86B1153.2) [DyLight 550] has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin, Flow (Cell Surface), Flow (Intracellular).
Expand 1 Items
Anti-FosB/G0S3 Mouse Monoclonal Antibody (DyLight 680) [clone: 83B1138]
Supplier: Novus Biologicals
The FosB / G0S3 Antibody (83B1138) [DyLight 680] from Novus Biologicals is a mouse monoclonal antibody to FosB / G0S3. This antibody reacts with human. The FosB / G0S3 Antibody (83B1138) [DyLight 680] has been validated for the following applications: Western Blot.
Expand 1 Items
Anti-FosB/G0S3 Mouse Monoclonal Antibody (DyLight 550) [clone: 83B1138]
Supplier: Novus Biologicals
The FosB / G0S3 Antibody (83B1138) [DyLight 550] from Novus Biologicals is a mouse monoclonal antibody to FosB / G0S3. This antibody reacts with human. The FosB / G0S3 Antibody (83B1138) [DyLight 550] has been validated for the following applications: Western Blot.
Expand 1 Items
Anti-BRCA1 Mouse Monoclonal Antibody (FITC (Fluorescein Isothiocyanate)) [clone: KEN]
Supplier: Novus Biologicals
The BRCA1 Antibody (KEN) [FITC] from Novus Biologicals is a mouse monoclonal antibody to BRCA1. This antibody reacts with human. The BRCA1 Antibody (KEN) [FITC] has been validated for the following applications: Immunocytochemistry / Immunofluorescence.
Expand 1 Items
Anti-CCNB1 Rabbit Monoclonal Antibody (DyLight 350) [clone: 2061A]
Supplier: Novus Biologicals
The Cyclin B1 Antibody (2061A) [DyLight 350] from Novus Biologicals is a rabbit monoclonal antibody to Cyclin B1. This antibody reacts with human. The Cyclin B1 Antibody (2061A) [DyLight 350] has been validated for the following applications: Western Blot, Flow Cytometry.
Expand 1 Items
Anti-TL1A/TNFSF15 Rabbit Monoclonal Antibody (DyLight 350) [clone: 2116C]
Supplier: Novus Biologicals
The TL1A / TNFSF15 Antibody (2116C) [DyLight 350] from Novus Biologicals is a rabbit monoclonal antibody to TL1A / TNFSF15. This antibody reacts with human. The TL1A / TNFSF15 Antibody (2116C) [DyLight 350] has been validated for the following applications: Western Blot.
Expand 1 Items
Anti-TGM3 Rabbit Polyclonal Antibody
Supplier: CLOUD-CLONE CORP MS
Polyclonal Antibody to Transglutaminase 3, Epidermal (TGM3), derived from recombinant TGM3 (Ala468~Glu693), is reactive with Mouse/Rat.
Expand 1 Items
Anti-ARSA Rabbit Polyclonal Antibody
Supplier: CLOUD-CLONE CORP MS
Polyclonal Antibody to Arylsulfatase A (ARSA), derived from recombinant ARSA (Arg19~Gly293), is reactive with Human/Mouse.
Expand 1 Items
Human Recombinant WNT5A (Prokaryotic) (from E. coli)
Supplier: CLOUD-CLONE CORP MS
This is a WNT5A recombinant protein (prokaryotic), Human is sequencing from Ile62~Lys380 with 90 - 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.
Expand 1 Items
Human Recombinant APOB100 (prokaryotic)(from E. coli)
Supplier: CLOUD-CLONE CORP MS
This is a APOB100 recombinant protein (prokaryotic), Human is sequencing from His3365~Glu3548 with 90 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.
Expand 1 Items
Anti-Caspase 8 Mouse Monoclonal Antibody (DyLight 680) [clone: 90A992]
Supplier: Novus Biologicals
The Caspase-8 Antibody (90A992) [DyLight 680] from Novus Biologicals is a mouse monoclonal antibody to Caspase-8. This antibody reacts with human, primate. The Caspase-8 Antibody (90A992) [DyLight 680] has been validated for the following applications: Western Blot, Flow Cytometry, Immunohistochemistry-Paraffin.
Expand 1 Items
Anti-TNFSF10 Mouse Monoclonal Antibody (DyLight 350) [clone: 55B709.3]
Supplier: Novus Biologicals
The TRAIL / TNFSF10 Antibody (55B709.3) [DyLight 350] from Novus Biologicals is a mouse monoclonal antibody to TRAIL / TNFSF10. This antibody reacts with human. The TRAIL / TNFSF10 Antibody (55B709.3) [DyLight 350] has been validated for the following applications: Western Blot, Immunohistochemistry-Paraffin.
Expand 1 Items
Anti-TNFSF10 Mouse Monoclonal Antibody (DyLight 680) [clone: 55B709.3]
Supplier: Novus Biologicals
The TRAIL / TNFSF10 Antibody (55B709.3) [DyLight 680] from Novus Biologicals is a mouse monoclonal antibody to TRAIL / TNFSF10. This antibody reacts with human. The TRAIL / TNFSF10 Antibody (55B709.3) [DyLight 680] has been validated for the following applications: Western Blot, Immunohistochemistry-Paraffin.
Expand 1 Items
Rat/Mouse PINP EIA, BioVendor
Supplier: BioVendor
96 wells (1 kit) - ELISA is a competitive enzyme immunoassay for the quantitative measurement of PINP.
Expand 1 Items
Anti-CCNB1 Rabbit Monoclonal Antibody (HRP (Horseradish Peroxidase)) [clone: 2061A]
Supplier: Novus Biologicals
The Cyclin B1 Antibody (2061A) [HRP] from Novus Biologicals is a rabbit monoclonal antibody to Cyclin B1. This antibody reacts with human. The Cyclin B1 Antibody (2061A) [HRP] has been validated for the following applications: Western Blot, Flow Cytometry.
Expand 1 Items
Anti-TL1A/TNFSF15 Rabbit Monoclonal Antibody (DyLight 650) [clone: 2116C]
Supplier: Novus Biologicals
The TL1A / TNFSF15 Antibody (2116C) [DyLight 650] from Novus Biologicals is a rabbit monoclonal antibody to TL1A / TNFSF15. This antibody reacts with human. The TL1A / TNFSF15 Antibody (2116C) [DyLight 650] has been validated for the following applications: Western Blot.
Expand 1 Items
Anti-TL1A/TNFSF15 Rabbit Monoclonal Antibody (DyLight 405) [clone: 2116C]
Supplier: Novus Biologicals
The TL1A / TNFSF15 Antibody (2116C) [DyLight 405] from Novus Biologicals is a rabbit monoclonal antibody to TL1A / TNFSF15. This antibody reacts with human. The TL1A / TNFSF15 Antibody (2116C) [DyLight 405] has been validated for the following applications: Western Blot.
Expand 1 Items
Human Recombinant IL-37 (from E. coli)
Supplier: Peprotech
Human IL-37 Recombinant Protein, Purity: >95% by SDS and HPLC, Source: E.coli, Biological Activity: By its ability to bind Interleukin-18 Binding Protein isoform a (IL-18 BPa) in functional ELISA, Synonyms: Interleukin
Expand 6 Items
Anti-Caspase 1 Mouse Monoclonal Antibody (DyLight 488) [clone: 14F468]
Supplier: Novus Biologicals
The Caspase-1 Antibody (14F468) [DyLight 488] from Novus Biologicals is a mouse monoclonal antibody to Caspase-1. This antibody reacts with human, mouse, rat. The Caspase-1 Antibody (14F468) [DyLight 488] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Expand 1 Items
Anti-Caspase 1 Mouse Monoclonal Antibody (DyLight 680) [clone: 14F468]
Supplier: Novus Biologicals
The Caspase-1 Antibody (14F468) [DyLight 680] from Novus Biologicals is a mouse monoclonal antibody to Caspase-1. This antibody reacts with human, mouse, rat. The Caspase-1 Antibody (14F468) [DyLight 680] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Expand 1 Items
Anti-Caspase 1 Mouse Monoclonal Antibody (DyLight 550) [clone: 14F468]
Supplier: Novus Biologicals
The Caspase-1 Antibody (14F468) [DyLight 550] from Novus Biologicals is a mouse monoclonal antibody to Caspase-1. This antibody reacts with human, mouse, rat. The Caspase-1 Antibody (14F468) [DyLight 550] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Expand 1 Items
Anti-BNIP3 Mouse Monoclonal Antibody (DyLight 405) [clone: ANa40]
Supplier: Novus Biologicals
The BNIP3 Antibody (ANa40) [DyLight 405] from Novus Biologicals is a mouse monoclonal antibody to BNIP3. This antibody reacts with human. The BNIP3 Antibody (ANa40) [DyLight 405] has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry / Immunofluorescence.