1810 Results for: "BMS-599626&amp"

Supplier: Abcam

Rabbit monoclonal [EPR22690-84] to ATF6 - ChIP Grade.

Supplier: Invitrogen

Thermo Scientific Pierce Boronic Acid Resin enables ribonucleotide and oligonucleotide RNA isolation.

Supplier: ANTIBODIES.COM LLC

Rabbit polyclonal antibody to WASF2 for WB, IHC and ELISA with samples derived from Human, Mouse and Rat.

Supplier: Enzo Life Sciences

Specific, potent and membrane permeant activator of the Epac cAMP receptor.

Supplier: Promega Corporation

Recombinant full-length human AMPK (combination of A1/B1/G1 subunits) was expressed by baculovirus in Sf9 insect cells using C-terminal His tags. AMPK is an important energy-sensing enzyme that monitors cellular energy status.

Supplier: Sino Biological

Produced in rabbits immunized with purified, recombinant Mouse Osteonectin / SPARC (rM Osteonectin / SPARC; Catalog#50494-M08H; NP_033268.1; Met 1-Ile 302). Total IgG was purified by Protein A affinity chromatography.

Supplier: Anaspec Inc

This is a fluorescent 5-FAM labeled scrambled Beta-Amyloid peptide, Abs/Em=494/521 nm.
Sequence: 5-FAM-AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
MW: 4873.4
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: PIP

The QRP BF finger cots are manufactured from a proven 100% natural latex formula blended with USDA-compliant blue coloring to eliminate blue rub-off and residue.

Supplier: Adipogen

NAD synthetase is an essential enzyme involved in both the de novo biosynthesis and salvage of NAD+, catalyzing the final step of both pathways

Supplier: Abnova

Rabbit polyclonal antibody raised against synthetic phosphopeptide of PRKAA1/PRKAA2.

Supplier: Prosci

AMPD3, Polyclonal antibody, Host: rabbit, Species: Human, Mouse, Isotype: Ig, Immunogen: generated from rabbits immunized with a KLH conjugated synthetic peptide between 325-356 amino acids from the Central region of human AMPD3. Synonyms

Supplier: Prosci

For WB starting dilution is: 1:1000 For IHC-P starting dilution is: 1:50~100 For FACS starting dilution is: 1:10~50

Supplier: STEMCELL Technologies

Serum-free culture supplement for expansion and differentiation of human granulocytes.

Supplier: STEMCELL Technologies

Serum-free culture supplement for expansion of human erythroid cells.

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Abnova

Mouse monoclonal antibody raised against recombinant PRKAA1.

Supplier: Abcam

Alexa Fluor® 488 Rabbit monoclonal [EPR22610-19] to ATF3.

Supplier: Prosci

For WB starting dilution is: 1:1000 For IHC-P starting dilution is: 1:50~100 For FACS starting dilution is: 1:10~50

Supplier: Abgent

Purified Rabbit Polyclonal Antibody (Pab). This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from a region within aa 450-550 of human AMPK alpha2. Specificity: H, M. Concentration: 0.25 mg/ml. Size: 0.1 mg.

Supplier: Invitrogen

The Pierce™ Peroxidase IHC Detection Kit bundles the Pierce™ Metal Enhanced DAB Substrate Kit with all necessary components to stain, counterstain and preserve experimental results with frozen or paraffin tissue sections.

Supplier: Prosci

For WB starting dilution is: 1:1000 For IF starting dilution is: 1:10~50 For FACS starting dilution is: 1:10~50

Supplier: Prosci

Inositol Monophosphatase 1 (IMPA1) belongs to the inositol monophosphatase family

Supplier: ANTIBODIES.COM LLC

Rabbit polyclonal antibody to CREB (phospho Ser133) for WB, IHC and ICC/IF with samples derived from Human, Mouse and Rat.

Supplier: Adipogen

NAD synthetase is an essential enzyme involved in both the de novo biosynthesis and salvage of NAD+, catalyzing the final step of both pathways

Supplier: Prosci

Xaa-Pro aminopeptidase 2 (XPNPEP2) belongs to the peptidase M24B family of metalloproteases

Supplier: Genetex

Rabbit polyclonal antibody to AMPK1 (phospho T174)

Supplier: Prosci

ATF3 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: Ig, Immunogen: KLH conjugated synthetic peptide between 140-168 AA from the C-terminal region, Synonym: cAMP-dependent transcription factor ATF-3, Activating transcription

Supplier: BTNX INC.

The Rapid Response™ multi-drug flat cup is an easy-to-use, one-step solution for drug screening that can simultaneously detect multiple drugs and metabolites in urine samples at specified cut-off levels.

Supplier: STEMCELL Technologies

Serum-free methylcellulose-based medium with recombinant cytokines for human ES and iPS cell-derived cells.

Supplier: Prosci

ATF2 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Isotype: Ig, Immunogen: KLH conjugated synthetic peptide between 318-347 amino acid from the Central region Human ATF2, Synonym: ATF2, CREB2, CREBP1, CREB-2,