1810 Results for: "BMS-599626&amp"

Supplier: Production Basics

The Power rail includes two sets of brackets that allow you to mount the power rail to the uprights or to the worksurface.

Supplier: Genetex

Rabbit Polyclonal antibody to PRPS1L1 (phosphoribosyl pyrophosphate synthetase 1-like 1)

Supplier: Sino Biological

This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human Osteonectin / SPARC (rh Osteonectin / SPARC; Catalog#10929-H08H; NP_003109.1; Met1-Ile303). The IgG fraction of the cell culture supernatant was purified by Protein A affinity chromatography.

Supplier: Avantor

This apparatus is full of activities.

Supplier: ANTIBODIES.COM LLC

Rabbit polyclonal antibody to WASF2 for WB, IHC and ELISA with samples derived from Human, Mouse and Rat.

Supplier: ANTIBODIES.COM LLC

Rabbit polyclonal antibody to CREB3L2 for WB and ELISA with samples derived from Human, Mouse and Rat.

Supplier: Prosci

For WB starting dilution is: 1:1000

Supplier: New England Biolabs (NEB)

The LongAmp® Taq 2X Master Mix combines high quality NEB recombinant Taq DNA Polymerase with a trace amount of Deep VentR™ DNA Polymerase

Supplier: Abnova

Rabbit polyclonal antibody raised against synthetic peptide of PRKAA1.

Supplier: Prosci

NAD synthetase is an essential enzyme involved in both the de novo biosynthesis and salvage of NAD+, catalyzing the final step of both pathways

Supplier: ANTIBODIES.COM LLC

Rabbit polyclonal antibody to CREB3L2 for WB and ELISA with samples derived from Human, Mouse and Rat.

Supplier: Abcam

Rabbit monoclonal [EPR19488] to ATF3 - BSA and Azide free.

Supplier: Prosci

For WB starting dilution is: 1:1000 For FACS starting dilution is: 1:10~50

Supplier: Abnova

Ampd2 Purified Maxpab Mouse Polyclonal Antibody (B01P); Mouse Polyclonal Antibody Raised Against A Full-Length Human Ampd2 Protein.; 50 Ug

Supplier: Abnova

Rabbit polyclonal antibody raised against synthetic phosphopeptide of PRKAA1.

Supplier: Abcam

Rabbit monoclonal [EPR22610-19] to ATF3 - BSA and Azide free.

Supplier: MilliporeSigma

Cholera toxin has a single A subunit surrounded by five polypeptides chains of the B subunits

Supplier: Abnova

This Immunopreciptitation/ Western Blot Antibody Pair set comes with one Antibody for Immunoprecipitation and another to detect the precipitated protein in Western Blot.

Supplier: Abnova

Rabbit polyclonal antibody raised against synthetic peptide of PRKAG1.

Supplier: MP Biomedicals

1,1-Dimethylbiguanide hydrochloride is suitable biguanide agent used in a study to investigate its role in enhancing the secretions of plasma active glucagon-like peptide-1 (GLP-1) levels.

Supplier: Genetex

Rabbit polyclonal antibody to AMPK alpha (phospho Thr172)

Supplier: Abnova

Rabbit polyclonal antibody raised against synthetic phosphopeptide of PRKAA1.

Supplier: Abcam

Rabbit monoclonal [EPR22690-84] to ATF6 - BSA and Azide free.

Supplier: Prosci

For IHC-P starting dilution is: 1:25 For WB starting dilution is: 1:1000

Supplier: Abnova

Rabbit polyclonal antibody raised against synthetic phosphopeptide of PRKAB1.

Supplier: Abnova

Rabbit polyclonal antibody raised against synthetic peptide of PRKAG1.

Supplier: Abgent

Polyclonal antibody, Isotype: Rabbit Ig, Species Reactivity: Human, Mouse, Gene ID: 272, Target/Specificity: Generated from rabbits immunized with a KLH conjugated synthetic peptide between 325-356 amino acids from the Central region of human AMPD3.

Supplier: Sino Biological

Produced in rabbits immunized with purified, recombinant Mouse Osteonectin / SPARC (rM Osteonectin / SPARC; Catalog#50494-M08H; NP_033268.1; Met 1-Ile 302). Total IgG was purified by Protein A affinity chromatography.

Supplier: PIP

The QRP BF finger cots are manufactured from a proven 100% natural latex formula blended with USDA-compliant blue coloring to eliminate blue rub-off and residue.

Supplier: Anaspec Inc

This is a fluorescent 5-FAM labeled scrambled Beta-Amyloid peptide, Abs/Em=494/521 nm.
Sequence: 5-FAM-AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
MW: 4873.4
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C