1910 Results for: "Anaspec"

Supplier: Anaspec

HIV protease (PR) is identified as an important drug-screening target for the design of selective acquired immunodeficiency syndrome (AIDS) therapeutics.

Supplier: Anaspec

HCV protease is identified as an important drug-screening target.

Supplier: Anaspec

Hydrogen peroxide is involved in a number of biological events, in particular, free radical-induced biochemical reactions.

Supplier: Anaspec

The SensoLyte® Plus 520 MMP-9 Assay Kit is designed for specifically detecting MMP-9 activity in biological samples which may contain multiple MMPs, such as culture medium, serum, plasma, synovial fluid, and tissue homogenate. A specific anti-MMP-9 monoclonal antibody is used in combination with a MMP fluorogenic substrate, 5-FAM/QXL®520 FRET peptide. The fluorescence signal is monitored at Ex/Em=490 nm/520 nm upon MMP-9-induced cleavage of the FRET substrate. Ample materials are provided to perform 96 assays in a 96-well format.

Supplier: Anaspec

HiLyte™ Fluor 647 acid, SE (Ex/Em=647 nm/ 679 nm) is an excellent fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy® 5 dyes, resulting in an optimal match to filters designed for Cy®5 dyes

Supplier: Anaspec

A lipophilic membrane stain that diffuses laterally to stain the entire cell; Its fluorescence is significantly enhanced upon membrane incorporation.

Supplier: Anaspec

HiLyte™ Fluor 555 acid, SE is an excellent amine-reactive fluorescent labeling dye that generates the protein conjugates that are only slightly red-shifted compared to those of Cy™ 3 dyes, resulting in an optimal match to filters designed for CyTM dyes.

Supplier: Anaspec

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-8 (neutrophil collagenase) is synthesized by neutrophils and stored in the specific granules until it is secreted.

Human MMP-8 is a full length pro-enzyme isolated from stimulated human neutrophil granulocytes. Proenzyme can be activated by incubating with 1 mM APMA at 37°C for 1 hr. Its activity can be measured in FRET-based enzymatic assays. 10-20 ng of enzyme is sufficient for FRET-based assay.

Supplier: Anaspec

HiLyte™ Fluor 488, SE is an excellent amine-reactive fluorescent labeling dye for generating protein conjugates. The spectrum of HiLyte™ Fluor488 is similar to fluorescein (FITC), resulting in an optimal match to filters designed for fluorescein.

Supplier: Anaspec

This kit is optimized to detect anti-human MOG (1-125) IgG in mouse serum or cerebrospinal fluid. Wells are pre-coated with recombinant human MOG (1-125) protein and pre-blocked with BSA. The amount of anti-human MOG IgG in serum or cerebrospinal fluid is quantified using ELISA. Mouse anti-human MOG IgG standard is included. Ample materials and reagents are provided to perform 96 assays in a 96-well plate format.

Supplier: Anaspec

Thiols, compounds that contain sulfhydryl group, are powerful reducing agents capable of acting as antioxidants, enzyme cofactors, and neuromodulators.

Supplier: Anaspec

β-galactosidase, encoded by the lacZ gene in E

Supplier: Anaspec

Glutathione (GSH) is an important antioxidant molecule that functions as a cofactor for a variety of enzymes and is involved in various biological processes

Supplier: Anaspec

B-Phycoerythrin (B-PE), a fluorescent protein from phycobiliprotein family, is isolated from cyanobacteria and eukaryotic algae. SMCC activated B-PE is chemically modified with SMCC. SMCC reacts with the primary amine on B-PE and introduces maleimide groups to B-PE. These maleimide groups easily react with thiol groups of target protein without the need for any additional activation, resulting in convenient conjugation of B-PE with proteins. Its primary absorption peak is at 545 nm with secondary peak at 563 nm. B-PE and the closely related R-PE are the most intensely fluorescent phycobiliproteins having orange fluorescence. They are significantly brighter and more photostable than conventional organic fluorophores. B-PE conjugates have been widely used in applications such as flow cytometry and multi-color immunofluorescent staining.

Supplier: Anaspec

Streptavidin is a nonglycosylated, tetrameric protein, with each subunit able to bind a single molecule of the vitamin biotin. Streptavidin-biotin bond is the strongest known non-covalent interaction with Kd ~10-15 M. Because streptavidin lacks any carbohydrate modification and has a near-neutral pI, it has the advantage of much lower nonspecific binding than avidin. Streptavidin is broadly used in various applications such as immunoassays, histochemistry, FISH (Fluorescence In Situ Hybridization), flow cytometry, microarrays and blot analysis.

Supplier: Anaspec

Cathepsin B is a member of the cathepsin family consisting of 12 cysteine proteases with broad exo- and endopeptidase activity

Supplier: Anaspec

The SensoLyte® Green Elastase Assay Kit is a FRET-based assay that detects elastase activity. The kit provides an elastin, natural substrate for elastases, labeled with 5-FAM fluorophore and QXL®520 quencher. Elastase-catalyzed hydrolysis yields brightly green fluorescence. Increase in fluorescence intensity is directly proportional to enzyme activity. The kit does not require any separation steps and can be used to continuously measure the kinetics of elastase.

Supplier: Anaspec

BACE2 (β-Secretase-2, Memapsin-1) belongs to the family of transmembrane aspartic proteases

Supplier: Anaspec

GST (Glutathione S-Transferase) enzymes, a family of isozymes plays a crucial role in body defense mechanisms against toxins and carcinogens

Supplier: Anaspec

The SensoLyte® ThT β-Amyloid (1-40) Aggregation kit provides a convenient and standard method to measure Aβ40 aggregation using Thioflavin T dye

Supplier: Anaspec

Cathepsin D is the lysosomal aspartic proteinase, active in intracellular protein breakdown

Supplier: Anaspec

This peptide is a histone H3 trimethylated at lysine 4 and is associated with transcription, specifically marking the transcription start site of actively transcribed genes. This peptide can be demethylated by Jumonji AT-rich interactive domanin 1 (JARID1) or by lysine demethylase 5 (KDM5) family of lysine demethylases.
Sequence: ART-K(Me3)-QTARKSTGGKAPRKQLA
MW: 2296.6 Da
% peak area by HPLC: 95
Storage condition: -20 °C

Supplier: Anaspec

This peptide is Histone H3 amino acid residues 31 to 41 di-methylated at Lys-36.
Sequence:STGGV-K(Me2)-KPHRY
MW:1257.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This FRET substrate peptide for Plasmepsin V (PMV) is derived from the conserved Plasmodium Export Element (PEXEL) motif of Histidine-Rich Protein II (HRPII). PMV is an ER aspartic protease that recognizes and cleaves the RXL sequence within the PEXEL motif of proteins exported by human malaria parasite Plasmodium falciparum, allowing them to translocate into host erythrocytes.
Sequence:Dabcyl-LNKRLLHETQ-EDANS
MW:1751.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is a myristoylated form of Autocamtide-3-Derived Inhibitory Peptide (AC3-I), a highly specific inhibitor of Calmodulin-Dependent Protein Kinase ll (CaMKII) that is resistant to proteolysis. AC3-I is derived from Autocamtide-3, a substrate for CaMKII, with the Thr-9 phosphorylation site substituted with Ala.
Sequence:Myr-KKALHRQEAVDAL
MW:1689.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is a biotinylated CGRP with a long chain linker attached at the N-terminus end.
Sequence:Biotin-LC-ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
MW:4128.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec

This peptide is a scrambled version of the Gap 27 domain of Connexin.
Sequence:REKIITSFIPT
MW:1304.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec

This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Sequence:KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
MW:3616.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is Histone H3 (21-44) with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2
MW:2932.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide sequence is derived from the Gag spacer peptide p1 that is encoded in the frameshift region of human immunodeficiency virus type 1 (HIV-1).
Sequence:HHHHHHIIKIIK
MW:1549.9 Da
% peak area by HPLC:95
Storage condition:-20° C