"Anaspec"

Supplier: Anaspec

DABCYL is one of the most popular acceptors for developing FRET-based nucleic acid probes and protease substrates. DABCYL, SE is the amino-reactive form of DABCYL, and widely used to prepare a variety of FRET-based probes that contain DABCYL.

Supplier: Anaspec

This peptide, with the diaminopimelic acid coupled to the gamma-carboxylic acid of the D-isomer of Glu, stimulates Nod1-dependent apoptosis.
Sequence:A-(g-e)-DAP
MW:390.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This sequence corresponds to the N-terminus of histone H3, spanning amino acids 1 to 25, amidated. Histones are small proteins (11–22 kDa) that mediate the folding of DNA into chromatin.
Sequence:ARTKQTARKSTGGKAPRKQLATKAA-NH2
MW:2625.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is derived from fibrinopeptide B amino acid residues 1-14. It is used as a mass spec (MS) standard in proteomic research.
Sequence:EGVNDNEEGFFSAR
MW:1570.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is H2-Kd-restricted enhanced green fluorescent protein (EGFP)-derived peptide (200-208) and represents a CD8 T cell epitope. Immunization with this peptide stimulates IFNg production, thus making this peptide a model tumor antigen for the experimental development of antigen-specific vaccines against cancer.
Sequence:HYLSTQSAL
MW:1019.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Calpains are a family of intracellular Ca2+ dependent cysteine proteases. They respond to Ca2+ signals by cleaving many specific proteins, thereby irreversibly modifying their function(s). They are implicated in a variety of Ca2+ regulated cellular processes as well as various pathological phenomena, such as ischemic injury, muscular dystrophy, diabetes, cataract, atherosclerosis, Alzheimer’s disease, and cancer. Calpains represent potential therapeutic targets for drug discovery.
This 27-residue peptide is derived from subdomain 1B of the repetitive domains of calpain, named peptide B27-WT. It is a potent inhibitor of calpain.
Sequence:DPMSSTYIEELGKREVTIPPKYRELLA
MW:3136.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is a 5-FAM-labeled Bid BH3 peptide. Bid is a pro-apoptotic member of the 'BH3-only' subset of the BCL-2 family proteins that constitute a critical control point in apoptosis. Bid interconnects extrinsic pathway TNFR1 and Fas death signals to the mitochondrial amplification of the intrinsic pathway. The references listed below belong to the unlabeled Bid BH3.
Sequence:5-FAM-EDIIRNIARHLAQVGDSMDR
MW:2667.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This Histone 4 peptide is acetylated at lysine 16. Lysine 16 of H4 appears to be a unique target for acetylation. Studies in yeast clearly indicate that acetylation of H4 lysine 16 is an independent specific function in relation to gene transcription when compared to other histone acetylation sites. It was also observed that a human histone acetyltransferase complex showed strong specificity for H4K16 in chromatin and, RNAi-mediated knockdown experiments revealed that it is responsible for the majority of H4 acetylation at lysine 16 in the cell.
Sequence:SGRGKGGKGLGKGGA-K(Ac)-RHRK
MW:2034.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is a Histone 3 peptide trimethylated at lysine 36. It's role has been indicative of defining exons, as certain nucleosome-enriched exons are observed to be enriched in some histone modifications. It is belived that this pattern of modification as seen with this H3K36me3 peptide, influences alternative splicing, perhaps by signaling effector proteins to mark particular exons for inclusion in the final transcript as they exit the RNA Polymerase II complex. It has also been shown in yeast that H3K36me3 gets deposited on histones as they are displaced by RNA polymerase II (RNAPII) during transcription. H3K36me3 then serves as a mark for HDACs to bind and deacetylate the histones.
Sequence:ATKAARKSAPATGGV-K(Me3)-KPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

β-galactosidase, encoded by the lacZ gene in E

Supplier: Anaspec

This peptide is a substrate for Jak3. It may be used used in kinase assays. Jak3tide contains the phosphorylation site at Tyr7.
Sequence:GGEEEEYFELVKKKK
MW:1813 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This heparin-binding peptide is derived from vitronectin (367-378). Vitronectin is a glycoprotein found in monomer form in the blood and oligomer form in the extraceullular matrix. This peptide has been shown to promote the adhesion and undifferentiated growth of human pluripotent stem cells.
Sequence:GKKQRFRHRNRKG
MW:1668 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Cecropin A is a naturally occurring, linear, cationic, 37-residue antimicrobial peptide. Cecropin A kills bacteria by dissipating transmembrane electrochemical ion-gradients.
Sequence:KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
MW:4003.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Calpains are a family of intracellular Ca2+ dependent cysteine proteases. They respond to Ca2+ signals by cleaving many specific proteins, thereby irreversibly modifying their function(s). They are implicated in a variety of Ca2+ regulated cellular processes as well as various pathological phenomena, such as ischemic injury, muscular dystrophy, diabetes, cataract, atherosclerosis, Alzheimer’s disease, and cancer. Calpains represent potential therapeutic targets for drug discovery.
This 7-amino-4-methylcoumarin (AMC) labeled peptide is widely used as a fluorogenic substrate for 20S proteasome, calpains and other chymotrypsin-like proteases. Cleavage of this AMC peptide by the enzymes generates strongly fluorescent AMC that is monitored fluorimetrically at Abs/Em=353/442 nm.
Sequence:Suc-LLVY-AMC
MW:763.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

6-TAMRA, SE is the other purified single isomer of 5(6)-TAMRA, SE. It is predominantly used for nucleotide labeling and DNA sequencing.

Supplier: Anaspec

Although DABCYL is one of the most popular acceptors for developing FRET-based nucleic acid probes and protease substrates, its extremely high hydrophobicity and resultant poor water solubility have limited its use in the development of sensitive fluorogenic FRET probes. DABCYL Plus™ is developed to address this limitation. DABCYL Plus™ retains spectral properties similar to those of DABCYL. This feature enables researchers to keep all assay settings similar to those of DABCYL’s probes. In addition, DABCYL Plus™ has much greater water solubility than DABCYL. We have used DABCYL Plus™ to develop various protease substrates. In some cases, it has demonstrated greatly improved enzyme performance.