"Anaspec"

Supplier: Anaspec

The microtubule-associated protein Tau, whose hyperphosphorylated form is associated to the Alzheimer's disease, is also known to be post-translationally modified by the addition of N-acetyl-D-glucosamine to some Ser or Thr. The Ser-400 tau O-GlcNAc modification was detected in rat brain.
Sequence:KWKHGAEIVYKSPVV-S(OGlcNAc)-GDTSPRHLSNVK-K(biotin)-NH2
MW:3677.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is histone H4 (1-25) with acetylation at Lys12. It is biotinylated through a C-terminal GSGSK linker. Lys12 acetylation is necessary for the methylation of Lys9 of histone H3 in the formation of heterochromatin. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLG-K(Ac)-GGAKRHRKVLRDN-GSGSK(Biotin)
MW:3274.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is Histone H3 amino acid residues 1 to 10 tri-methylated at Lys-4.
Sequence:ART-K(Me3)-QTARKS
MW:1188.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is histone H4 amino acids 1 to 16, acetylated at Lys-16 and at the N-terminus. This peptide also contains a GG linker, followed by a biotinylated lysine. The acetylation of histone H4 causes structural changes that play a crucial role in amplifying the binding of transcription factors to specific recognition sites within the nucleosome.
Sequence:Ac-SGRGKGGKGLGKGGA-K(Ac)-RHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This 20 amino acid peptide binds to the amyloid form of beta-Amyloid (1-40) but not to monomeric beta-Amyloid (1-40). This sequence represents new potential carrier molecules to deliver medicines to amyloid plaques in AD patients and to image plaques in AD brains. The ability to directly target reagents to the amyloid form of the beta-Amyloid peptide may allow the delivery of neuroprotective agents to make amyloid plaques less toxic, the delivery of amyloid-destroying molecules to eliminate plaques, or the delivery of reagents to prevent amyloid plaque formation. This sequence is biotinylated on the N-terminus.
Sequence: Biotin-DWGKGGRWRLWPGASGKTEA
Molecular Weight: 2441.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

APP (C31): this 31-amino acid peptide corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Sequence:AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
MW:3717.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is beta-Amyloid (1-13), human sequence.
Sequence: DAEFRHDSGYEVH
Molecular Weight: 1561.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
MW: 4757.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

Serine/threonine phosphatase substrate.
Sequence:KR-pT-IRR
MW:909 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is a 38 residue inactive big endothelin-1 intermediate that gives rise to a shorter active peptide produced in vascular endothelial cells.
Sequence:CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
MW:4384.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec

Aggrecanases belong to the ADAMTS (A disintegrin and metalloprotease with thrombospondin motif) family of proteases. Aggrecanases cleave aggrecan, the major structural component of cartilage. Aggrecanase-1 (ADAMTS-4) is a major aggrecanase in human osteoarthritic cartilage.
This FRET peptide was used in an ADAMTS-4 (Aggrecanase-1) assay. Ex/Em = 340/420 nm.
Sequence:Abz-TEGEARGSVI-Dap(Dnp)-KK-NH2
MW:1644.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide belongs to the influenza hemagglutinin (HA) family and is responsible for attaching the virus to cell receptors and initiating infection.
The HA tag is used as a general epitope tag in expression vectors. Many recombinant proteins have been engineered to express the HA tag, which does not appear to interfere with the bioactivity or the biodistribution of the recombinant protein. The HA tag is not suitable for detection or purification of proteins from apoptotic cells since it is cleaved by Caspase-3 and / or Caspase-7 after its sequence DVPD, causing it to lose its immunoreactivity.
Sequence:YPYDVPDYA
MW:1102.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Cholecystokinin (CCK) acts both as a hormone and a neurotransmitter and is found in the GI system and the central nervous system. It is a satiety peptide that inhibits food intake.
This Cholecystokinin (CCK) analog retains all the bioactivities of CCK8, but was found to be remarkably more stable in acidic media and unaffected by air oxidation due to Met replacements (Thr 28 and Nle31 were substituted for Methionine). The predominant conformation contains a gamma-turn centered on Thr4, separated by Gly5 from a helical segment that comprises the C-terminal residues.
Sequence: RD-Y(SO3H)-TGW-Nle-DF-NH2
MW: 1251.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

VIP (1−12), vasoactive intestinal peptide fragment 1-12 with a mass of 1425.5 da, is mostly used as a standard in mass spectrometry
Sequence:HSDAVFTDNYTR
MW:1425.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec

This peptide is a fragment of myelin basic protein (MBP), which corresponds to amino acids 88-102 in mouse, 88-104 in guinea pig and 89-105 in human. It is acetylated in N-term.
Sequence:Ac-FFKNIVTPRTPPPSQGK-NH2
MW:1956 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases, atherosclerosis, cancer, obesity and related diseases