"Anaspec"

Supplier: Anaspec

A control peptide for LSKL (inhibitor of thrombospondin).
Sequence:SLLK - NH2
MW:458.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec

This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure–activity studies show that hpGRF(1–29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (>93%) homology with procine, bovine and ovine GRF (1-29)-NH2.
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
MW: 3357.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

This peptide is derived from tyrosinase-related protein 2 (TRP2) residues 180-188. TRP2 belongs to the melanocyte differentiation antigens and has been implicated as a target for immunotherapy of human as well as murine melanoma. Studies show that this TRP2 derived peptide can bind to mouse and human MHC class I molecules. Immunization with TRP2 peptide loaded dendritic cells (DCs) results in effective induction of antitumor immunity.
Sequence:SVYDFFVWL
MW:1175.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is a peptide fragment (979-989) of the insulin receptor substrate-1 containing the sequence motif YMXM known to bind to the two domains of SH2 on the 85kDa subunit of phosphoinositide 3-kinase.
Sequence:KKSRGDYMTMQIG-NH2
MW:1513.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (45-73) is a 29-amino acid long peptide derived from the Exon 2/Insert 1 domain.
Sequence:ESPLQTPTEDGSEEPGSETSDAKSTPTAE
MW:2977.97 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is derived from Aβ (12-28), which represents a binding site for apolipoprotein E (apoE). apoE is a genetically inherited risk factor for Alzheimer’s disease that promotes aggregation of toxic Aβ. Substitution of Val18 to proline competitively.Sequence: VHHQKLPFFAEDVGSNK
Molecular Weight: 1953.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

Protein A-HiLyte™ Fluor 647 Conjugate can be used as a universal reagent to detect primary antibodies in IHC from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (near-infrared) Excitation/Emission wavelength: 649 nm/674 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development

Supplier: Anaspec

Penetratin is a cell-penetrating peptide (CPP), also known as a protein transduction domain (PTD), of which the first 16 amino acids are derived from the third helix of the Antennapedia protein homeodomain. Penetratin linked to a phosphodiester oligonucleotide is capable of permeating through neuronal cell membranes and down-regulating genes.
Sequence:RQIKIWFQNRRMKWKKGG
MW:2360.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

The secreted alkaline phosphatase (SEAP) is widely used as reporter gene to analyze gene expression including kinetic analysis over time in cell culture or animals owing to its unique ability to secrete into culture medium and serum

Supplier: Anaspec

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components

Supplier: Anaspec

This peptide is amino acids 276 to 286 fragment of the lymphocytic choriomeningitis virus (LCMV) glycoprotein (GP), also known as GP276. It is the H-2Db restricted epitope. LCMV has been routinely exploited for the study of adaptive immune responses to viral infection. Fifty to seventy percent of CD8 T cells at the peak of LCMV infection appear to be specific for five LCMV-derived epitopes including GP276.
Sequence:SGVENPGGYCL
MW:1095.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.
Sequence:FKRIVQRIKDFLRNLV
MW:2045.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Histatin 5 is a human basic salivary anti-microbial peptide with strong fungicidal properties.
Sequence:DSHAKRHHGYKRKFHEKHHSHRGY
MW:3036.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is derived from Histone H3 21-44 amino acids, and is usually used as a substrate for methylation assays. It has been used as a substrate for protein arginine methyltransferases
Sequence:ATKAARKSAPATGGVKKPHRYRPG
MW:2505.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This sequence corresponds to amino acids 3-13 from murine MBP. MBP induces immune reactivity in multiple sclerosis (MS), a chronic inflammatory demyelinating disease of the CNS. MBP (3-13) is a substrate for Protein Kinase C.
Sequence:QKRPSQRSKYL
MW:1390.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is a C-terminal surface sorting signal with a conserved LPXTG motif, labeled with the Dabcyl/Edans FRET pair. Sortase cleaves surface proteins at the LPXTG motif and catalyzes the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Sortases are a family of Gram-positive transpeptidases responsible for anchoring surface protein virulence factors to the peptidoglycan cell wall layer. Surface proteins of Staphylococcus aureus are anchored to the bacterial cell wall by a mechanism requiring this C-terminal sorting signal. Cell wall sorting is the covalent attachment of surface proteins to the peptidoglycan via a C-terminal sorting signal that contains a consensus LPXTG sequence. Cleavage of this FRET substrate by sortase reveals the fluorescent signal that may be measured to study sortase activity. Inhibition of the sortase activity is a potential way of treatment of the staphylococcal infection. The LPXTG motif is conserved in more than 100 surface proteins of Gram-positive pathogens.
Sequence:Dabcyl-QALPETGEE-Edans
MW:1472.6 Da
% peak area by HPLC:95
Storage condition:-20° C