"Anaspec"

Supplier: Anaspec

A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 6 units of gammaGlu-Cys.
Sequence:(γE-C)6-G
MW:1468.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Uroguanylin is a natriuretic peptide, a hormone that regulates sodium excretion by the kidney when excess NaCl is consumed. Uroguanylin and guanylin are related peptides that activate common guanylate cyclase signaling molecules in the intestine and kidney. Uroguanylin was isolated from urine and duodenum but was not detected in extracts from the colon of rats.
Sequence:TDECELCINVACTGC (Disulfide bonds between Cys4-Cys12 and Cys7-Cys15)
MW:1569.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec

Maleimides are among the most frequently used reagents for thiol modification. In most proteins, the sites of reactions are at cysteine residues that either are intrinsically present or result from reduction of cystines. Unlike iodoacetamides, maleimides do not react with histidines and methionines under physiological conditions. Tetramethylrhodamine-5-maleimide is widely used for thiol modifications of peptides and proteins.

Supplier: Anaspec

This is an acetylated alpha tubulin peptide at lysine 40 with a C-terminal WG linker followed by a biotinylated lysine. The acetylation at lysine 40 of this peptide is shown to have a therapeutic interest in diseases involving altered intracellular transport such as Huntington's disease. Histone Deacetylase (HDAC) inhibitors have been shown to increase vesicular transport of brain derived neurotrophic factor thereby increasing acetylation of tubulin at lysine 40.
Sequence: Ac-GIQPDGQMPSD-K(ac)-TIGGGDDSFNWG-K(biotin)
MW: 2918.2Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Reactive pH indicator for slightly acidic pH range

Supplier: Anaspec

Peptide sequence KVEKIGEGTYGVVYK is derived from the amino acid residues CDC26-20. It is considered to be a generic substrate for various TPKs.
Sequence:KVEKIGEGTYGVVYK
MW:1669.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Antimicrobial peptide LL-37,  belongs  to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human.  It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds.  Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution. 
Sequence: [LL-37, 37 aa]
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec

This Bim peptide belongs to the pro-apoptotic group of the Bcl-2 family of proteins.
Sequence:DMRPEIWIAQELRRIGDEFNAYYARR
MW:3269.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

The calpains are a family of intracellular Ca²⁺ supdependent cysteine proteases

Supplier: Anaspec

H3K69 methylation is generally associated with transcriptional activation, with methylation catalyzed by DOT/DOT1L enzyme in the context of a nucleosome. Aberrant methylation of H3K79 has been implicated in leukemias. Histone H3 (69-89) peptides are used for assessing the specificity of anti-H3K79me antibodies.
Sequence:RLVREIAQDFKTDLRFQSSAV-NH2
MW:2479 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This human recombinant SIRT2 is in its active form, and can be used for enzyme activity assays. The recombinant human Sirtuin 2 (GenBank Accession #: NM_030593) with 13-319 amino acids and His tag at its C-terminal was expressed in E. coli. The molecular mass of the enzyme is approximately 35.5 kDa on SDS-PAGE.
Sirtuins comprise a unique class of nicotinamide adenine dinucleotide (NAD+)-dependent deacetylases (class III HDACs) targeting multiple protein substrates.
Sirtuin 1 (SIRT1), the human homolog of yeast Sir2 (Silent Information Regulator 2), is the most studied of the seven members of sirtuin family. SIRT1 have been implicated in several important cellular processes, including genomic stability and DNA repair, p53-mediated apoptosis, adipogenesis, and aging.
Substrates for SIRT2 are not limited to histones but also include various transcription factors and co-regulators that modulate metabolic, cell cycle and cell death related pathways. Human SIRT2 is a cytoplasmic protein that increases in abundance during mitosis and regulates major events of cytokinesis.

Supplier: Anaspec

This C-terminal biotinylated Aß(1-40) contains a 6-carbon long chain (LC) to provide more accesibility for avidin attachment.

Supplier: Anaspec

Glutathione (GSH) is an important antioxidant molecule that functions as a cofactor for a variety of enzymes and is involved in various biological processes

Supplier: Anaspec

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Supplier: Anaspec

The native peptide PKTPKKAKKL (60026-1) is derived from histone H1 peptide sequence that is docked in the active site of cyclin-dependent kinase 5. It is an effective CDK5 substrate (Km = 40 µM).
Sequence:PKTPKKAKKL
MW:1138.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Cathepsin B is a member