"Anaspec"

Supplier: Anaspec

This peptide is Histone H3 amino acid residues 1 to 21 acetylated at Lys-9 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)
MW:2765.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is a peptide fragment (979-989) of the insulin receptor substrate-1 containing the sequence motif YMXM known to bind to the two domains of SH2 on the 85kDa subunit of phosphoinositide 3-kinase.
Sequence:KKSRGDYMTMQIG-NH2
MW:1513.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is beta-amyloid (1-42) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-42). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-42) and Aß (11- 42) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

The SensoLyte® Plus 520 MMP-2 Assay Kit is designed specifically for detecting MMP-2 activity in biological samples, such as culture medium, serum, plasma, synovial fluid, and tissue homogenate, which may contain multiple MMPs. A monoclonal anti-human-MMP-2 antibody is employed to pull down MMP-2 from the mixture first. MMP-2 activity is then quantified by a 5-FAM/QXL® 520 fluorescence resonance energy transfer (FRET) peptide. The fluorescence signal is monitored at Ex/Em=490 nm/520 nm upon MMP-2-induced cleavage of the FRET substrate. The long wavelength fluorescence of 5-FAM is less interfered by the autofluorescence of components in biological samples and test compounds. Ample materials are provided to perform 96 assays in a 96-well format.

Supplier: Anaspec

TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (45-73) is a 29-amino acid long peptide derived from the Exon 2/Insert 1 domain.
Sequence:ESPLQTPTEDGSEEPGSETSDAKSTPTAE
MW:2977.97 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

The secreted alkaline phosphatase (SEAP) is widely used as reporter gene to analyze gene expression including kinetic analysis over time in cell culture or animals owing to its unique ability to secrete into culture medium and serum

Supplier: Anaspec

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components

Supplier: Anaspec

This is a Pannexin-1 (Panx1) mimetic blocking peptide. Pannexin-1 is a recently identified membrane protein that can form gap junction-like connections allowing intercellular passage of dyes when overexpressed in two adjacent oocytes or mammalian epithelial cell lines. Blockade of pannexin-1 in macrophage endogenously expressing the ATP-gated P2X7 receptor (P2X7R) blocks the initial dye uptake, but not the ionic current, and also blocks processing and release of interleukin-1beta (IL-1beta) in response to P2X7R activation.
Sequence:WRQAAFVDSY
MW:1242.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide corresponds to the protein transduction domain of the TAT protein and is synthesized with an activated cysteine residue C(Npys), wherein Npys is 3-Nitro-2-pyridinesulfenyl group and is used for activating S of cysteine and for rapid reaction when a thiol group is introduced. This is synthesized with C(Npys) at the N-terminus for applications requiring specific conjugation reactions and has a fluorophore labeled with FAM having Abs/Em=494/518 nm. This kind of modification has been used to render this peptide as a cell penetrating and carrier peptide applicable in conjugation studies.
Sequence: C(Npys)YGRKKRRQRRR-K(FAM)-NH2
MW: 2302.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec

Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptides is a highly soluble fluorogenic MMP substrate for MMP-2, 8, 12, 13 and 14, containing the MMP cleavable Gly-Leu bond and EDANS/DABCYL. Fluorogenic assays using TNO211 are sensitive and can detect MMP activity in culture medium from endothelial cells and untreated synovial fluid from patients. Abs/Em = 340/490 nm.
Sequence:DABCYL-(γ-Abu)-PQGL-E(EDANS)AK-NH2
MW:1326.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This modified gp100 peptide amino acids 209 to 217 is a MHC-associated HLA-A2.1-restricted epitope derived from melanoma antigen. It can be processed, presented, and recognized by T cells. Alteration of the G209 peptide to G209-2M at the second amino acid changing threonine to a methionine was found to increase the affinity for MHC-associated HLA-A2.1 resulting in enhanced induction of T cells reactive to native gp100
Sequence:IMDQVPFSV
MW:1035.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Protein A-HiLyte™ Fluor 555 Conjugate can be used as a universal reagent to detect primary antibodies in IHC from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (orange) Excitation/Emission wavelength: 553 nm/568 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development

Supplier: Anaspec

This is a C-terminal Lys(Biotin-LC) modified b-Amyloid peptide, residues 1 to 17. 6-aminohexanoate (LC) is used as a spacer.
Sequence: DAEFRHDSGYEVHHQK-K(Biotin-LC)-NH2
Molecular Weight: 2421.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

Urokinase-type plasminogen activator (uPA) is a serine protease that functions in the conversion of the zymogen plasminogen to the active, broad-spectrum serine protease plasmin

Supplier: Anaspec

In Alheimer's Disease brains, plaques contain amino-terminal truncated beta-Amyloid peptides including the alpha secretase-generated p3 fragments, beta-Amyloid 17-40 and 17-42. They were shown to induce pro-inflammatory cytokine and chemokine production in vitro and in vivo.

Supplier: Anaspec

A highly specific neutrophil elastase substrate, Abs/Em=380/500 nm.
Sequence:MeOSuc-AAPV-AFC
MW:681.7 Da
% peak area by HPLC:95
Storage condition:-20° C