"Anaspec"

Supplier: Anaspec

This insulin B-chain peptide binds to a class II histocompatibility complex (MHC) allele called I-Ag7. A number of autoimmune diseases has been linked to class II proteins encoded by the MHC. Type 1 diabetes, or insulin-dependent diabetes mellitus, is a T cell-mediated disease that results in autoimmune destruction of pancreatic beta-cells leading to hyperglycemia. This insulin B peptide may be a self-antigen candidate that could initiate the disease. Immunization with this peptide in mice led to autoantibodies and insulitis.
Sequence: SHLVEALYLVCGERG
MW: 1645.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

Cathepsin L, a lysosomal endopeptidase, is a member of the papain-like family of cysteine proteinases

Supplier: Anaspec

This peptide consists of amino acids 1-23 of histone H4 attached at the C-terminal by a GSGS linker to biotinylated lysine. It is used as a substrate for histone acetyltransferase (HAT) assays. Biotinylation allows the peptide to be captured on streptavidin or agarose beads.
Sequence:SGRGKGGKGLGKGGAKRHRKVLR-GSGSK(Biotin)
MW:3003.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

The GRGDS peptide contains the amino acid sequence Arg-Gly-Asp (RGD), which has been implicated as a recognition site in interactions between extracellular matrix (ECM) molecules and cell membrane receptors. RGD-containing synthetic peptides are known to inhibit attachment of endothelial cells to substrates. GRGDS peptide inhibits angiogenesis in serum-free collagen gel culture. This synthetic peptide mimics the cellular binding site of many adhesive proteins in the extracellular matrix and causes rounding and detachment of spread cells. This peptide is biotinylated through 6-aminohexanoate (LC) as a spacer.
Sequence:Biotin-LC-GRGDS
MW:830 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Histone deacetylase (HDAC) enzymes act as transcriptional repressors of genes through the deacetylation of lysine residues on histone proteins

Supplier: Anaspec

[125I]-(Pyr1)Apelin-13 binds with high affinity and selectivity to human cardiac tissue.
Sequence:Pyr-RPRLSHKGPMPF-OH
MW:1533.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec

The native peptide,RRLIEDAEYAARG (cat# 22581), is derived from pp60src, and considered to be a generic substrate for various protein tyrosine kinases. The fluorescent and biotinylated peptides are used to design a variety of assays for PTKs.
Sequence:RRLIEDAE-pY-AARG
MW:1599.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is Histone H3 amino acid residues 23 to 34.
Sequence:KAARKSAPATGG
MW:1114.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death
Sequence:GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
MW:4103.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec

HiLyte™ Fluor 488 acid, SE is an excellent amine-reactive fluorescent labeling dye that generates the protein conjugates far superior to those of fluorescein derivatives such as FITC.

Supplier: Anaspec

This is amino acids 54 to 65 fragment of sulfated hirudin, a 65-residue peptide. Hirudin is found in the saliva of the leech Hirudo medicinalis. This sulfated peptide binds tightly to anion-binding exosite I of thrombin, but does not inhibit hydrolysis of synthetic peptide substrates.
Sequence:Ac-GDFEEIPEE-Y(SO3H)-LQ
MW:1590.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec

Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin D is the lysosomal aspartic proteinase, active in intracellular protein breakdown. Cathepsin D is involved in the pathogenesis of several diseases such as breast cancer and Alzheimer disease. Cathepsin E is a non-lysosomal aspartic proteinase of the pepsin superfamily. It plays an important role in the protein degradation, the generation of bioactive proteins, and antigen processing. Recent studies have particularly suggested that Cathepsin E is important in host defense against cancer cells and invading microorganisms.
An internally quenched fluorogenic substrate (Ab/Em =328/393 nm) for cathepsins D and E and not for B, H or L, obtained from the hepatopancreas (liver) of the Japanese common squid (Todarodes pacificus). The cleavage occurs at the Phe-Phe amide bond resulting in enhanced fluorescence and is used in screening cathepsin D and E inhibitors and for determining cathepsin D and E activity in tissue cell extracts.
Sequence:Mca-GKPILFFRLK(Dnp)-r-NH2
MW:1756.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

6-HEX, SE is a popular amino-reactive fluorescent probe that is widely used in nucleic acid sequencing and related research.

Supplier: Anaspec

EMP17 is an erythropoietin (EPO)-mimetic peptide. Erythropoietin (EPO) is the hormone involved in red blood cell production, which activates its receptor by binding to the receptor's extracellular domain and presumably dimerizing two receptor monomers to initiate signal transduction. EMP contains two potentially reactive amines, one at the amino terminus of the peptide and one in the side chain of the single lysine within the peptide sequence.
Sequence: TYSCHFGPLTWVCKPQGG
MW: 1981.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Supplier: Anaspec

This is the 22-35 fragment of b-Amyloid peptide (human, mouse, rat).
Sequence: EDVGSNKGAIIGLM
Molecular Weight: 1403.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C