1910 Results for: "Anaspec"

Supplier: Anaspec

This peptide is histone H4 (1-25) with acetylation at Lys12. It is biotinylated through a C-terminal GSGSK linker. Lys12 acetylation is necessary for the methylation of Lys9 of histone H3 in the formation of heterochromatin. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLG-K(Ac)-GGAKRHRKVLRDN-GSGSK(Biotin)
MW:3274.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

TAMRA is one of the most popular fluorophores used in various bioconjugations. 5-TAMRA is the purified single isomer of 5(6)-TAMRA. It is preferred for some complicated biological applications where reproducibility is more critical than material cost since the minor positional difference between 5-TAMRA and 6-TAMRA might affect some biological properties of the underlying conjugates.

Supplier: Anaspec

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-10 (stromelysin 2) is involved in several pathological conditions, such as cancer, arthritis and wound healing. MMP-10 is secreted as zymogen with a prodomain, a catalytic domain, a hinge region, and a hemopexin-like domain. It can activate other MMPs such as MMP-1, MMP-8 and degrade a variety of substrates, including gelatin, collagens III, IV and V, fibronectin, aggrecan

This recombinant human MMP-10 was expressed as a pro-enzyme enzyme from its DNA sequence7 transfected into a mouse myeloma cell line, NS0. The apparent Mr on SDS-PAGE is 58-kDa. Incubation with 1 mM APMA at 37°C for 1-2 hours will activate pro-MMP-10. Its activity can be measured by FRET peptides

Supplier: Anaspec

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-14 (MT1-MMP), membrane-type MMP, plays an important role in tumor invasion. MMP-14 is expressed on the surface of invasive tumor cells, in stromal cells of human colon, breast, and head and neck carcinomas. MMP-14 is secreted as zymogen with a prodomain, a catalytic domain, a hinge region, a hemopexin-like domain, and a transmembrane domain. It can activate pro-MMP-23 and degrade a variety of substrates, including fibrillar collagens I, II, III, fibronectin, vitronectin and laminin-1.

A truncated human MMP-14 with His-tag was expressed in E. coli. The Mr on SDS-PAGE is 31-kDa. Incubation with 1 mM APMA at 37°C for 2 hr will activate MMP-14. Its activity can be measured by FRET peptides

Supplier: Anaspec

The AnaTag™ APC Labeling Kit is optimized for use in the conjugation of allophycocyanin (APC) to antibodies. APC is an ultra-sensitive, near-infrared fluorescent tracer with a high quantum yield (Ex/Em = 650 nm/660 nm). APC- labeled antibodies are used in applications such as flow cytometry and immunofluorescence. The AnaTagTM APC Labeling Kit contains SH-reactive APC. SMCC modified allophycocyanin reacts with the thiol groups of target antibody without the need for additional activation, thus simplifying the conjugation protocol. AnaTagTM APC Labeling Kit contains a chemically cross-linked APC (CL-APC) that is much more stable than the native APC, but still retains the original spectroscopic properties. The amount of APC supplied in this kit is sufficient for labeling up to 1 mg of antibody. The kit provides all reagents, purification columns and a detailed step-by-step protocol. Cross-linked and SMCC-activated APC are also available as separate products.

Supplier: Anaspec

Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases, atherosclerosis, cancer, obesity and related diseases

Supplier: Anaspec

Fluorescein isothiocyanate (FITC) remains one of the most popular fluorescent labeling reagents, probably due to the low cost of the material. 5-FITC and 6-FITC have very similar absorption and fluorescence spectra. However, the isomers may differ in their binding and reactivity to proteins, and the conjugates may elute under different chromatographic conditions or migrate differently in electrophoretic gels.

Supplier: Anaspec

Plasmin belongs to the family of serine proteases

Supplier: Anaspec

β-galactosidase, encoded by the lacZ gene in E. coli, is widely used as a reporter enzyme to study gene expression, protein-protein interaction and normalization of transfection efficiency in mammalian cells.

Supplier: Anaspec

Peptide sequence KVEKIGEGTYGVVYK is derived from the amino acid residues CDC26-20. It is considered to be a generic substrate for various TPKs.
Sequence:5-TMR-KVEKIGEGTYGVVYK
MW:2082.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Bombesin is a 14-aa peptide originally isolated from the fire-bellied toad. It has two mammalian homologs, neuromedin and Gastrin-Releasing Peptide (GRP). It binds with high affinity to the GRP receptor, a member of the G-protein-coupled receptor family. It stimulates gastrin release from G cells, and acts in the brain to stop eating behavior.
Bombesin is also a tumor marker for lung small cell carcinoma, neuroblastoma, pancreatic cancer and gastric cancer.
Sequence:Pyr-QRLGNQWAVGHLM-NH2
MW:1620.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

The octapeptide angiotensin II (Ang II) exerts a wide range of effects on the cardiovascular system. It is also implicated in the regulation of cell proliferation, fibrosis and apoptosis. Ang II is formed by cleavage of Ang I by the angiotensin-converting enzyme (ACE) or chymases. Human heart chymase, a chymotrypsin-like serine proteinase, hydrolyzes the Phe8-His9 bond to yield the octapeptide hormone angiotensin II and His-Leu.
Sequence: DRVYIHPF
MW: 1046.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec

Magainin 2 assumes an amphiphilic helix when bound to acidic phospholipids, forming a pore composed of a dynamic, peptide-lipid supramolecular complex.
Sequence:GIGKFLHSAKKFGKAFVGEIMNS
MW:2466.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Oxytocin (OT) is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons in the supraoptic and paraventricular nuclei and is secreted by the posterior pituitary gland. It is also secreted from other tissues, such as the ovaries and testes. Circulating OT is important during parturition and lactation. In the pregnant uterus, oxytocin and the oxytocin receptor play a major part for uterine contractility and the induction of labor. OT is also involved in complex social behaviors such as affiliation, sexual behavior, social recognition, stress buffering, aggression, and trust.
Sequence: CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
MW: 1007.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

This is a 38 residue inactive big endothelin-1 intermediate that gives rise to a shorter active peptide produced in vascular endothelial cells.
Sequence:CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
MW:4384.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec

Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: Biotin-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4344.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

The native peptide, PLARTLSVAGLPGKK (cat# 22511), is a selective substrate for CaM kinase II and protein kinase C. It is a poor substrate for phosphorylase kinase and is not phosphorylated by myosin light chain kinase. The sequence of PLARTLSVAGLPGKK is homologous to phosphorylation site 2 in glycogen synthase. The relative Vmax/Km ratios of the peptide for different kinases are 100 for CaMK II, 22 for protein kinase C, 2 for phosphorylase kinase, and 0.5 for myosin light chain kinase respectively.
Sequence:PLARTLSVAGLPGKK
MW:1507.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

The sequence (Accession # NP_001116849) corresponding to the full length human DJ-1 protein along with N-terminal GST tag was expressed in E. coli. The recombinant DJ-1 protein was purified from bacterial lysate using GST affinity chromatography followed by GST tag cleavage and removal. The molecular weight of the recombinant DJ-1 protein is 19.9 kDa.
DJ-1 is also known as PARK7 (Parkinson disease protein 7). It is a 189-amino acid protein that is ubiquitously expressed in many organs including brain, liver, kidney, pancreas, heart, and others. Although DJ-1 was originally discovered as a novel oncogene product, it was found to play several other roles in biological processes. This includes the regulation of RNA binding activity, fertility, anti-oxidative stress, and is linked to the early onset of Parkinson disease when mutated. Sequence (Accession# NP_001116849) corresponds to the full length human DJ-1 protein and was expressed in E. coli.

Supplier: Anaspec

The sequence (Accession # NP_003076)) corresponds to the human β-synuclein along with a 6x His tag expressed in E. coli. This human β-synuclein recombinant protein is offered at a low endotoxin level of <0.1 EU per μg protein.
Beta-synuclein belongs to the family of highly conservative proteins in vertebrates. N-terminal of β-synuclein is highly homologous to α-, γ-synucleins and consists of degenerative “KTKEGV” repeats. Similar to α-synuclein, beta-synuclein is found primarily in the brain; however, it does not associate with Lewy bodies in Parkinson disease like α-synuclein. Beta-synuclein was found to inhibit production of phosphatidic acid by the phospholipase D2 transmembrane protein in vitro. In addition, beta-synuclein was detected in many breast and ovarian tumors. Recent investigations demonstrated that beta-synuclein can induce mild experimental autoimmune encephalomyelitis (EAE) in Lewis rats.
The human β-synuclein recombinant proteins from AnaSpec are offered with low endotoxin levels of <1 EU per μg protein.

Supplier: Anaspec

This cyclic peptide is a potent vasodilator. It is more powerful than the linear GRGDSP in changing the vascular tone of arterioles isolated from rat cremaster muscle.
Sequence:GRGDSP, N to C cyclized
MW:569.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is a fluorescent (TAMRA)-labeled Angiotensin II, Abs/Em = 541/565 nm.
Sequence: TAMRA-DRVYIHPF
MW: 1458.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec

(Arg)9 is a cell-permeable peptide used for drug delivery.It can traverse the plasma membrane of eukaryotic cells.
Sequence:RRRRRRRRR
MW:1423.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Bovine ß-Casein, monophosphopeptide (phospho-Serine) can be used for characterization of affinity purified phosphorylated peptides in liquid chromatography and for the analysis or detection of phosphorylated peptides in mass spectrometry.
Sequence:FQ-pS-EEQQQTEDELQDK
MW:2062 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

[Ala13]-Apelin-13 is an Apelin-13 antagonist evidenced from its blood pressure lowering reversal effects in hypertensive rats.
Sequence:QRPRLSHKGPMPA
MW:1474.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec

This is a fluorescent (FAM)-labeled TAT peptide, Abs/Em = 494/521 nm.
Sequence: FAM-YGRKKRRQRRR
MW: 1918.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec

This is a biotinylated HIV-derived cell penetrating TAT peptide . This positively charged biotin-peptide has been used in studies to form a colloidal coat over oligonucleotides-saturated nanoparticles such that TAT-coated nanoparticles when loaded with dense SiRNA molecules could efficiently penetrate a wide variety of human embryonic stem cells.
Sequence: Biotin-YGRKKRRQRRR
MW: 1786.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec

This peptide sequence is found in residues 89 to 113 of human MOG (Myelin Oligodendrocyte Glycoprotein). Studies suggest this is an HLA-DR2 restricted MOG epitope.
Sequence: RFSDEGGFTCFFRDHSYQEEAAMEL
MW: 2973.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec

This is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin presented by the class I MHC molecule, H-2Kb. It is fluorescent (5-FAM)-labeled, Abs/Em=494/521 nm.
Sequence: 5-FAM-SIINFEKL-NH2
MW: 1320.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec

26Rfa is a neuropeptide belonging to the RFamide peptide family. It exhibits orexigenic activity and has been associated to obesity. The primary structures of human, rat, and frog 26RFa exhibit 80% identity, and the C-terminal octapeptide is fully conserved from amphibians to mammals.
Sequence:TSGPLGNLAEELNGYSRKKGGFSFRF-NH2
MW:2832.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This sequence corresponds to the first 21 amino acids of the NH2 terminal of histone H3 followed by a GG linker and a biotinylated lysine. This peptide was used to investigate the characteristics and mechanisms of ethanol-induced histone H3 acetylation in rat hepatocytes. Immunocytochemical and immunoblot analyses revealed that ethanol treatment significantly increased H3 acetylation at Lys9 with negligible effects at Lys14, 18, and 23.
Sequence:ARTKQTARKSTGGKAPRKQLA-GGK(Biotin)-NH2
MW:2723.2 Da
% peak area by HPLC:95
Storage condition:-20° C