1910 Results for: "Anaspec"

Supplier: Anaspec

C-peptide is cleaved from proinsulin, stored in secretory granules, and eventually released into the bloodstream in amounts equimolar with those of insulin. The measurement of the C-peptide is an important test for the beta-cell function. In the red blood cells of type 2 diabetic patients, Na+,K+ ATPase activity is strongly related to blood C-peptide levels. C-peptide signal transduction in human renal tubular cells involves the activation of phospholipase C and PKC-delta and PKC-varepsilon, as well as RhoA, followed by phosphorylation of ERK1/2 and JNK and a parallel activation of Akt. C-peptide shows specific binding to a G-protein-coupled membrane binding site, resulting in Ca2+ influx, activation of mitogen-activated protein kinase signalling pathways and stimulation of Na+, K+ ATPase and endothelial nitric oxide synthase.
Sequence: EAEDLQVGQVELGGGPGAGSLQPLALEGSLQ
MW: 3020.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

Histatin 5 is a human basic salivary anti-microbial peptide with strong fungicidal properties.
Sequence:DSHAKRHHGYKRKFHEKHHSHRGY
MW:3036.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

C-terminal analogue of C3a, agonist of the C3a receptor
Sequence:WWGKKYRASKLGLAR
MW:1820.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

QXL® 570 dyes are optimized quenchers for rhodamines (such as TAMRA, sulforhodamine B, ROX) and Cy3 fluorophores.

Supplier: Anaspec

Acrylodan is a thiol-reactive dye whose fluorescence is very sensitive to conformational changes, and is well-adapted to protein structural analyses.

Supplier: Anaspec

2,3-Naphthalenedialdehyde (NDA) ≥95% (by HPLC), Ultra Pure Grade

Supplier: Anaspec

A substrate for DNA-dependent protein kinase (DNA-PK), phosphorylation. DNA-PK is essential for the repair of DNA double-strand breaks. This peptide corresponding to 11–24 amino acids of human p53 with threonine 18 and serine 20 changed to alanine is used as a substrate for the assay of DNA-PK activity
Sequence:EPPLSQEAFADLWKK
MW:1759 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is an N-terminally biotinylated peptide, with a phosphorylated Thr97. The sequence APRTPGGRR contains a native sequence derived from bovine myelin basic protein amino acids 95-98 (PRTP). The rest of the sequence is not derived from a native sequence, but is a synthetic construct. APRTPGGRR is specific for MAP kinases: p44MAPK [extracellular signal-regulated kinase 1 (ERK1)] and p42MAPK (ERK2). It contains the consensus sequence Pro-X-(Ser/Thr)-Pro that is recognized by MAP kinase. APRTPGGRR is the most efficient substrate for phosphorylation reaction by ERK and is phosphorylated by kinases on threonine 97 and can also be phosphorylated by MAPK p38.
Sequence:Biotin-APR-pT-PGGRR
MW:1273.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Secretin, a 27-amino acid gastrointestinal peptide hormone, has been implicated in numerous regulatory events involving the pancreas, biliary tree, stomach, nerves and kidney. It is relatively conserved through evolution. Rat secretin differs from its porcine counterpart by a single glutamine-for-arginine substitution at position 14.
Sequence: HSDGTFTSELSRLQDSARLQRLLQGLV-NH2
MW: 3028.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

This is a the tandem repeat sequence of the MUC1 mucin core. MUC1 is a high molecular weight glycoprotein over-expressed by adenocarcinomas, and by different types of bladder tumors. It is also expressed by normal human epithelial cells.
Sequence:APDTRPAPG
MW:1484.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.
Sequence:VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
MW:3467.86 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.
Sequence:FKRIVQRIKDFLRNLV
MW:2045.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (45-73) is a 29-amino acid long peptide derived from the Exon 2/Insert 1 domain.
Sequence:ESPLQTPTEDGSEEPGSETSDAKSTPTAE
MW:2977.97 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is derived from the Neh2 domain of nuclear factor (erythroid-derived 2)-like 2, or Nrf2. Nrf2 is a bZIP transcription factor that regulates the expression of antioxidative and cytoprotective genes. The DxETGE motif of this peptide binds Keap1 Kelch adaptor protein and displaces Nrf2 from Keap1.
Sequence:LQLDEETGEFLPIQ
MW:1631.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is histone H3 (1-21) symmetrically dimethylated at Arg8 with a methyl group added to each nitrogen of the guanidinium group. This peptide is biotinylated at the epsilon side chain of an additional C-terminal Lys. Methylation at Arg8 blocks G9a methylation of Lys9. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTA-R(Me2s)-KSTGGKAPRKQLA-K(Biotin)
MW:2637.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker followed by a biotinylated lysine. It is tri-methylated at lysine 20.
Sequence:Ac-KGLGKGGAKRHR-K(Me3)-VLRDNIQGITWG-K(biotin)
MW:3184.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is a monomethylated lysine at position 9 of the 1-21 amino acid histone H3 peptide. This form of histone methylation is characterized as being enriched around transcription start sites. This peptide has been used as a control peptide in a TR-FRET assay for identifying inhibitors of histone lysine demethylases.
Sequence:ARTKQTAR-K(Me1)-STGGKAPRKQLA
MW:2269.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is Histone H3 amino acid residues 73 to 83 tri-methylated at Lysine 79. Histone lysine methylation plays a role in transcriptional regulation. H3K79 can be methylated by Dot1 methyltransferase.Related Peptides: Histone H3 (73-83), Cat# 65437 [Lys(Ac)79]-Histone H3 (73-83), H3K79(Ac), Cat# 65438 [Lys(biotin)79]-Histone H3 (73-83), H3K79(biotin), Cat# 65440
Sequence:EIAQDF-K(Me3)-TDLR
MW:1378.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is derived from bovine peripheral myelin P2 protein amino acid residues 53-78. It is neuritogenic, inducing experimental autoimmune neuritis (EAN) in Lewis rats.
Sequence:TESPFKNTEISFKLGQEFEETTADNR
MW:3019.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This cyclic RGD peptide contains a subsituted d-Tyr instead of d-Phe on the fourth position. Substitution with Tyr results in a high affinity and selectivity for the a_vb3 integrin. Substitution with Tyr also allows for electrophilic radiohalogenation if desired.
Sequence:Cyclo(-RGDyK)
MW:619.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This product contains 0.03 mg (net) of the 32 CEF peptides for a total of 1 mg in one vial. Used in the stimulation of IFNγ release from CD8+ T cells in individuals with defined HLA types, these epitopes are useful in applications such as ELISPOT, intracellular cytokine and CTL assays.
% peak area by HPLC: ≥ 95
Storage condition: -20°C

Supplier: Anaspec

BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec

A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 5 units of gammaGlu-Cys.
Sequence:(γE-C)5-G
MW:1236.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide corresponds to human, bovine (119-126), mouse, rat (118-125) and Heparin-Binding Growth Factor 2 (118-125) residues of bFGF. It inhibits dimerization and activation of bFGF receptors.
Sequence:KRTGQYKL
MW:993.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is derived from tyrosinase-related protein 2 (TRP2) residues 180-188. TRP2 belongs to the melanocyte differentiation antigens and has been implicated as a target for immunotherapy of human as well as murine melanoma. Studies show that this TRP2 derived peptide can bind to mouse and human MHC class I molecules. Immunization with TRP2 peptide loaded dendritic cells (DCs) results in effective induction of antitumor immunity.
Sequence:SVYDFFVWL
MW:1175.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Mass spec standard
Sequence:DAF-L*-GSF-L*-YEYSR [L* = L(U13C6, 15N)]
MW:1581.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide corresponds to the protein transduction domain of the TAT protein and is synthesized with an activated cysteine residue C(Npys), wherein Npys is 3-Nitro-2-pyridinesulfenyl group and is used for activating S of cysteine and for rapid reaction when a thiol group is introduced. This is synthesized with C(Npys) at the N-terminus for applications requiring specific conjugation reactions and has a fluorophore labeled with FAM having Abs/Em=494/518 nm. This kind of modification has been used to render this peptide as a cell penetrating and carrier peptide applicable in conjugation studies.
Sequence: C(Npys)YGRKKRRQRRR-K(FAM)-NH2
MW: 2302.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec

This peptide is angiontensin I (Ang I) with valine and isoleucine universally labeled with 13C and N. Ang I is a precursor to Ang II, which has been implicated in cardiovascular functions, cell proliferation, fibrosis, and apoptosis. The 10-mer Ang I peptide is converted to Ang II through the cleavage of the Phe8-His9 bond of Ang I by angiotensin-converting enzyme (ACE) or human chymase.

Supplier: Anaspec

This sequence is from the C-terminal sequence of the P and V proteins of Simian Virus 5.
Sequence:GKPIPNPLLGLDST
MW:1421.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

In one study where this peptide was labeled with 125I, it was found to bind specifically and with high affinity to alpha-v/beta-3 receptors on neovascular blood vessel sections of different major human cancers. The integrin alpha(IIb)beta(3)-specific cyclic hexapeptide contains an Arg-Gly-Asp (RGD) sequence.
Sequence:Cyclo(-RGDfK)
MW:603.7 Da
% peak area by HPLC:95
Storage condition:-20° C