"Anaspec"

Supplier: Anaspec

Centrally administered N-terminal fragments of ACTH (1-10, 4-10, 4-9) display convulsant properties in rabbits.
Sequence: SYSMEHFRWG
MW: 1299.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec

This peptide is an inhibitor for Angiotensin I Converting Enzyme (ACE I), derived from Bradykinin. ACE I partially suppresses the renin-angiotensin-aldosterone system (RAAS), which regulates blood pressure and may mediate hypertension. ACE I converts angiotensin I to the biologically active peptide angiotensin II using a zinc- and chloride- dependent mechanism.
Sequence: RPPGFSPFR
MW: 1060.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec

Human calcitonin reduces blood calcium, opposing the effects of parathyroid hormone (PTH). It stimulates cyclic nucleotide accumulation in human kidney cortex and medulla. Calcitonin maybe involved in osteoporosis and in Paget's disease.
Sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
MW: 3417.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

A 32-amino acid long peptide with a disulfide bridge between Cys1 and Cys7 and C-terminal amidated Proline, Calcitonin (CT) is involved plasma calcium level. Compared to human or rat calcitonin, Salmon Calcitonin (sCT) is more potent in its biological actions such as inhibition of osteoclasts resorption of bones, renal ion excretion modulation, and others. The reason for its potency has been attributed to the fact that sCT forms an amphipathic helix in its amino acids 9-19 region.
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
MW: 3431.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

Multiple Antigenic Peptides (MAPs) are synthetic peptides with 4 branches harboring 2 Lysines each. The Lys residues are used as a scaffold to support 8 peptides. MAPs are used to increase the mass of the peptide entity when used as antigen in immunizations. They represent an alternative to carrier proteins, such as BSA or KLH.
Sequence:K4K2KA - NH2
MW:985.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

A vesicular stomatitis virus G (VSV-G) protein fragment.
Sequence:YTDIEMNRLGK
MW:1339.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide belongs to the influenza hemagglutinin (HA) family and is responsible for attaching the virus to cell receptors and initiating infection.
The HA tag is used as a general epitope tag in expression vectors. Many recombinant proteins have been engineered to express the HA tag, which does not appear to interfere with the bioactivity or the biodistribution of the recombinant protein. The HA tag is not suitable for detection or purification of proteins from apoptotic cells since it is cleaved by Caspase-3 and / or Caspase-7 after its sequence DVPD, causing it to lose its immunoreactivity.
Sequence:YPYDVPDYA
MW:1102.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors.
Sequence: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
MW: 4504.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36) and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 4111.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

In Alheimer's Disease brains, plaques contain amino-terminal truncated beta-Amyloid peptides including the alpha secretase-generated p3 fragments, beta-Amyloid 17-40 and 17-42. They were shown to induce pro-inflammatory cytokine and chemokine production in vitro and in vivo.

Supplier: Anaspec

This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 40-1.
Sequence: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

Anionic interaction of Aß(1-11) with Factor XII is suspected to cause the massive activation of the C4 (Complement 4) system in cerebrospinal fluid of Alzheimer’s disease patients.
Sequence: DAEFRHDSGYE
Molecular Weight: 1325.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

This is the 22-35 fragment of b-Amyloid peptide (human, mouse, rat).
Sequence: EDVGSNKGAIIGLM
Molecular Weight: 1403.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

Osteocalcin (OC) is a 49 amino acid peptide found exclusively in bone tissue and is highly conserved among species. It is a vitamin K- and D-dependent protein produced by osteoblasts, osteocytes and odontoblasts. It is deposited in extracellular bone matrix and is found in the serum. Serum osteocalcin, hydrolysed in the kidney and liver, is considered a specific marker of osteoblast activity and bone formation rate. It may be involved in regulation of osteoblast function, regulation of bone turnover and/or mineralization.
Sequence: YLYQWLGAPVPYPDPL-Gla-PRR-Gla-VC-Gla-LNPDCDELADHIGFQEAYRRFYGPV (Gla=γ-Carboxyglutamic Acid; Disulfide bridge: 23-29)
MW: 5929.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

PET (Positron Emission Tomography) imaging of [Lys3]-bombesin is able to detect gastrin-releasing peptide receptor (GRPR) positive prostate cancer. An immunoconjugate of [Lys3]-bombesin and corresponding monoclonal antibody can specifically induce (CD64)-dependent monocyte and neutrophil-mediated lysis of small cell carcinoma.
Sequence:Pyr-QKLGNQWAVGHLM-NH2
MW:1591.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

[Lys0]-BK(1-10) is one of the two main Bradykinin peptides that act as a mediator of inflammation with evidence showing its release at high nanomolar concentrations into the tear-film of ocular allergic patients.
Sequence:KRPPGFSPFR
MW:1188.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C