Order Entry
Puerto Rico
Orders LinkContactUsLinkComponent
1910 results for "Anaspec"

"Anaspec"

1910 Results
Sort by

PUMA BH3

Supplier: Anaspec

This is a PUMA (p53 upregulated modulator of apoptosis) BH3 domain peptide. PUMA together with Bcl-xL, and cytoplasmic p53 coordinate p53 functions. PUMA proteins bind Bcl-2, localize to the mitochondria, and induce cytochrome C release and apoptosis in response to p53. PUMA may be a direct mediator of p53-induced apoptosis.
Sequence:EEQWAREIGAQLRRMADDLNAQYER
MW:3049.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Glucagon-Like Peptide 1, GLP-1 amide, FAM-labeled

Supplier: Anaspec

This is fluorescent GLP-1 labeled at the peptide C-terminus with FAM, Abs/Em=494/521 nm. In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36)-and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 4469.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 2 Items
Loading...

Chicken OVA (323-339), TAMRA (5-Carboxytetramethylrhodamin)

Supplier: Anaspec

This is a class II (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin presented by the class II MHC molecule, H-2Kb. It is fluorescently labeled with 5-TAMRA, Abs/Em = 541/565 nm.
Sequence: 5-TAMRA-ISQAVHAAHAEINEAGR
MW: 2186.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...

Human GIP (1-42)

Supplier: Anaspec

GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4983.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 2 Items
Loading...

Histone H3 (21-44)-GK, Biotin

Supplier: Anaspec

This peptide is Histone H3 (21-44) with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2
MW:2932.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Mouse;Rat Amylin

Supplier: Anaspec

Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...

Human [Cys26]-beta-Amyloid (1-42)

Supplier: Anaspec

This peptide is beta-amyloid (1-42) with substitution of Ser26 to Cys. This peptide has been used in a number of fluorescent tagged experiments and suited for fluorescent probe labeling.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA
MW: 4530.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 2 Items
Loading...

5-Bromo-2'-deoxyuridine (broxuridine)

Supplier: Anaspec

Biomarker for cell cycle and cell proliferation

Expand 1 Items
Loading...

[Lys(Me1)4]-Histone H3 (1-21)

Supplier: Anaspec

This is a monomethylated lysine at position 4 of the 1-21 amino acid histone H3 peptide. This form of histone methylation is characterized as being enriched around transcription start sites. It’s chromatin mark was also closely correlated to cell-type specific expression of putative gene targets of enhancers. It was also noted from a genome wide study that most potential regulatory elements were enriched only by the mono-methylated version of this histone 3.
Sequence:ART-K(Me1)-QTARKSTGGKAPRKQLA
MW:2268.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Beta-Amyloid (3-40)

Supplier: Anaspec

This peptide is beta-amyloid (1-40) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-40). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-40) and Aß (11- 40) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4143.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...

Human Beta-Amyloid (1-40) HFIP

Supplier: Anaspec

Removal of any preexisting structures in lyophilized stocks of Aβ-peptide is the critical initial step for controlled aggregation studies. HFIP has been shown to break down β-sheet structure, disrupt hydrophobic forces in aggregated amyloid preparations, and promotes α-helical secondary structure. HFIP treatment of lyophilized Aβ-peptide resulted in a dense, homogeneous preparation of unaggregated peptide and samples can be stored as peptide films.

Expand 2 Items
Loading...

Ryanodine receptor 1 Peptide

Supplier: Anaspec

This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Sequence:KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
MW:3616.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Substance P

Supplier: Anaspec

Substance P (SP) is an important neuropeptide belonging to the tachykinin family. It acts as a neurotransmitter and neuromodulator. It is closely related to neurokinin A, both originating from the same precursor preprotachykinin A. It is released from the terminals of sensory nerves and is involved in inflammation and pain processes.
Sequence:RPKPQQFFGLM-NH2
MW:1347.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 2 Items
Loading...

ACE2 Inhibitor

Supplier: Anaspec

A potent inhibitor specific for ACE2. It has a Ki of 2.8 nM.
Sequence:Ac-GDYSHCSPLRYYPWWKCTYPDPEGGG-NH2
MW:3076.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

Mouse;Rat Kisspeptin-10 (Kp-10)

Supplier: Anaspec

Kisspeptin was originally identified as a human metastasis suppressor gene that has the ability to suppress melanoma and breast cancer metastasis. Kisspeptin-GPR54 signaling has an important role in initiating secretion of gonadotropin-releasing hormone (GnRH) at puberty from the anterior pituitary.
This peptide sequence is found in residues 45 to 54 of Metastin (also referred to as Kisspeptin-10). This peptide increases plasma concentrations of GH (Growth Hormone) and LH (Luteinizing Hormone) in prepubertal dairy heifers. This peptide is the minimal sequence needed to activate GPR54 signaling, which may function in negatively regulating CXCR4’s role in programming tumor metastasis. Specifically, Kisspeptin-10 inhibits signaling and chemotaxis induced by SDF-1.
Sequence:YNWNSFGLRF-NH2
MW:1302.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Src Optimal Peptide Substrate

Supplier: Anaspec

The synthetic peptide has been identified as a Src optimal peptide substrate. It may be used to measure the wild type Src activity in comparison with other family members.
Sequence:AEEEIYGEFEAKKKK
MW:1799 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...
Recommendations

Recommendations will be personalized based on your shopping preferences only if you have given your consent by enabling "Enhance my Shopping Experience" on the "Personal Info page".

Otherwise, you will receive generic recommendations.