4987 Results for: "Anaspec Inc"

Supplier: Anaspec Inc

Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: Biotin-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4344.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

The native peptide, PLARTLSVAGLPGKK (cat# 22511), is a selective substrate for CaM kinase II and protein kinase C. It is a poor substrate for phosphorylase kinase and is not phosphorylated by myosin light chain kinase. The sequence of PLARTLSVAGLPGKK is homologous to phosphorylation site 2 in glycogen synthase. The relative Vmax/Km ratios of the peptide for different kinases are 100 for CaMK II, 22 for protein kinase C, 2 for phosphorylase kinase, and 0.5 for myosin light chain kinase respectively.
Sequence:PLARTLSVAGLPGKK
MW:1507.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 1-21. It is dimethylated at lysine 18 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAPR-K(Me2)-QLA-GGK(Biotin)-NH2
MW:2750.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is beta-Amyloid (1-13), human sequence.
Sequence: DAEFRHDSGYEVH
Molecular Weight: 1561.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This is a histone 4 peptide acetylated at lysine 8. In some studies, this histone modification is thought to predict prognosis of resected non-small-cell lung cancer. This peptide has also been shown to play a role in somatic hypermutation (SHM) possible owing to its modification that likely mediates recruitment of error-prone DNA polymerases at the DNA repair stage of SHM.
Sequence:SGRGKGG-K(Ac)-GLGKGGAKRHRK
MW:2034.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is cysteine conjugated to LL-37 via a LC linker. This type of modified LL-37 can be used for KLH, BSA or OVA conjugation.
Sequence: C - LC - [LL-37, 37 aa]
MW: 4709.7 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

Substitution of Ser 26 with Cys in Aβ1-40 allows the generation of the covalently linked Aβ40 homodimer. Dimerization can be reverted by adding a reducing agent. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV
Molecular Weight: 4345.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This is H2A, one of the core histones DNA associates with to form nucleosome. This 1-20 H2A peptide is unique among histones in that its C-terminal end is exposed for potential covalent modifications.
Sequence: SGRGKQGGKARAKAKTRSSR
MW:2087.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is histone H4 (1-21), acetylated at lysine 12. The N-terminus contains a C-terminus GG linker followed by a biotinylated lysine. The acetylation of histone H4 plays a crucial role in structural changes that amplifies the binding of transcription factors to their recognition sites within the nucleosomes. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:Ac-SGRGKGGKGLG-K(Ac)-GGAKRHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a cell adhesive peptide (RGDC), capable of binding to surface Zr alkoxide complexes through (maleimido) alkylcarboxylate intermediates. This peptide may be used to stimulate human osteoblast attachment.
Sequence:RGDC
MW:449.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is histone H3 amino acid residues 1 to 21. It is asymmetrically dimethylated at arginine 8 with both methyl groups added to one nitrogen of the guanidinium group, and contains a C-terminal biotinylated lysine.
Sequence:ARTKQTA-R(Me2a)-KSTGGKAPRKQLA-K(Biotin)-NH2
MW:2636.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

HiLyte™ Fluor 532 hydrazide is a carbonyl-reactive fluorescent labeling dye.

Supplier: Anaspec Inc

Fluorogenic cytochrome P-450 substrate that generates red fluorescent product upon enzyme cleavage

Supplier: Anaspec Inc

Ghrelin is an appetite stimulating peptide hormone secreted by stomach P/D1-type cells in humans and circulates in the bloodstream during fasting conditions.  Enzymatically n-octanoylated Serine3 of this 28-amino acid Ghrelin, also known as acyl-Ghrelin (AG), is the endogenous ligand specific for growth hormone secretagogue receptor 1a (GHSR1a). The GHSR1a receptor appears to be dedicated to Ghrelin and is widely expressed in different tissues. 
Sequence: GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR
MW: 3370.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

Beta-Casomorphin-7 is a milk opioid peptide derived from fragment 60-66 of bovine beta-Casein. It strongly stimulates mucin secretion in the rat jejunum through a nervous pathway and mu-opioid receptor activation. The presence of the Tyr-Pro aromatic sequence makes the peptide selective for the mu receptor while the high contents of proline residues in the sequence makes the peptide resistant to degradation by gastrointestinal enzymes.
Sequence: YPFPGPI
MW: 789.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This is a fluorescent (FAM)-labeled Endothelin 1 peptide, Abs/Em = 494/521 nm.
Sequence:FAM-CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
MW:2850.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 15-36 with a C-terminal GG linker followed by a biotinylated lysine. It is symmetrically dimethylated at arginine 26 with a methyl group added to each nitrogen of the guanidinium group.
Sequence:APRKQLATKAA-R(Me2s)-KSAPATGGVK-GGK(biotin)
MW:2704.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

HiLyte™ Fluor 750 amine is a carbonyl-reactive fluorescent labeling dye. Spectrally similar to Cy7 dye, HiLyte™ Fluor 750 amine is the longest-wavelength carbonyl-reactive HiLyte™ Fluor dye currently available.

Supplier: Anaspec Inc

Maleimides are among the most frequently used reagents for thiol modification. In most proteins, the site of reaction is at cysteine residues that either are intrinsically present or result from reduction of cystines. Unlike iodoacetamides, maleimides do not react with histidines and methionines under physiological conditions. Fluorescein-5-maleimide is one of the most popular fluorescent dyes for thiol modifications of proteins.

Supplier: Anaspec Inc

5-FAM cadaverine is an excellent building block to prepare fluorescent ligands for receptor binding assays. Additionally, we have proven that the fluorescein cadaverine derivative is also a good transglutaminase substrate for site-specific protein labeling like FITC cadaverine.

Supplier: Anaspec Inc

Spectra of HiLyte™ Fluor 555 conjugates are slightly red-shifted compared to those of Cy3 dyes, resulting in an optimal match to filters designed for Cy3 dyes.

Supplier: Anaspec Inc

Tetramethylrhodamine-6 C2 maleimide is a good alternative to tetramethylrhodamine-6-maleimide with excitation/emission wavelength at 544/572 nm. Its spectral characteristics are very close to those of tetramethylrhodamine-6-maleimide (+2 nm). It is 40% less expensive compared to tetramethylrhodamine-6-maleimide, and can be used for thiol modification of proteins, antibodies and peptides.

Supplier: Anaspec Inc

HiLyte™ Fluor 750 hydrazide is a carbonyl-reactive fluorescent labeling dye. It can be used for labeling glycoproteins such as HRP.

Supplier: Anaspec Inc

This peptide corresponds to the protein transduction domain of the TAT protein and is synthesized with an activated cysteine residue C(Npys), wherein Npys is 3-Nitro-2-pyridinesulfenyl group and is used for activating S of cysteine and for rapid reaction when a thiol group is introduced. This kind of modification has been used to render this peptide as a cell penetrating and carrier peptide applicable in conjugation studies.
Sequence: C(Npys)YGRKKRRQRRR-NH2
MW: 1816.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

(Arg)9 is a cell-permeable peptide used for drug delivery. It can traverse the plasma membrane of eukaryotic cells, and can be easily conjugated to the molecule to be internalized
Sequence:C(Npys)RRRRRRRRR-NH2
MW:1680.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

A linear integrin binding peptide. It inhibits endothelial cell adhesion to fibroblast growth factor-2 and to fibronectin.
Sequence:GRGDSPK
MW:715.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide, derived from the BH3 domain of Bak (Flu-BakBH3), has been shown to have high-affinity binding to a surface pocket of the Bcl-XL protein that is essential for its death antagonist function.
Sequence:GQVGRQLAIIGDDINR
MW:1724.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide, a double cyclic peptide, binds preferentially to integrins at sites of tumor angiogenesis and inflammed synovium in-vivo, and can be internalized into targeted cells.
Sequence:ACDCRGDCFCG (Disulfide bridge: 2-10 and 4-8)
MW:1145.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide contains 5-FAM only and is similar to the proteolytic product of the 520 MMP FRET substrates. It can be used to set up the fluorescence standard curve. Abs/Em = 494/521 nm.
Sequence:5-FAM-PL
MW:586.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. RELATED PRODUCTS:Beclin-1, Cat# 65466Tat-Beclin-1, scrambled, Cat# 65468
Sequence: YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
MW: 3741.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C