4987 Results for: "Anaspec Inc"

Supplier: Anaspec Inc

This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.
Sequence:YCWSQYLCY (Disulfide bridge: 2-8)
MW:1226.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Protegrin-1 (PG-1) with a modified C-terminal amide. PG-1 is an 18-amino-acid beta-hairpin antimicrobial peptide found in porcine leukocytes and belongs to the cathelicidin family. PG-1 exhibits broad-spectrum activity unaffected by extracellular NaCl concentrations and is capable of inactivating numerous bacterial strains, Candida albicans, and some enveloped viruses. The efficacy is strongly dependent upon the existence of two disulfide bonds that stabilize the beta-sheet structure.
Sequence:RGGRLCYCRRRFCVCVGR-NH2 (disulfide bridge:6-15 and 8-13)
MW:2155.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 1 to 10 mono-methylated at Lys-4.
Sequence:ART-K(Me1)-QTARKS
MW:1160.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and 1-43), are identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease. The length of the C-terminus is a critical determinant of the rate of amyloid formation (“kinetic solubility”), with only a minor effect on the thermodynamic solubility. Amyloid formation by the kinetically soluble peptides (e.g. 1-39) can be nucleated, or “seeded” by peptides which include the critical C-terminal residues (1-42, 26-42, 26-43, 34-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Molecular Weight: 4230.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This is amino acids 17 to 26 fragment of p53, fluorescent labeled through an LC spacer. This peptide is the Mdm-2 binding domain of p53 known also as p53N. This sequence contains all of the residues that come into contact with the binding domain of Mdm-2. The tumor suppressor protein p53 is important in maintaining genome stability and in preventing cancer development, FITC (Abs/Em=493 nm/517 nm)..
Sequence:FITC-LC-ETFSDLWKLL-NH2
MW:1753.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is derived from Large T antigen residue 47 to 55 (PKKKRKVED). It is a commonly used nuclear localization signal (NLS) peptide. It enables protein import into cell nucleus.
Sequence:CGGGPKKKRKVED
MW:1401.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a fragment of the murine heart muscle specific peptide derived from a-myosin H chain. This peptide was used for induction of autoimmune myocarditis.
Sequence:Ac-RSLKLMATLFSTYASADR
MW:2073.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 1 to 21 tri-methylated at Lys-9 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTAR-K(Me3)-STGGKAPRKQLA-GGK(Biotin)
MW:2765.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Histatin 5 is a human basic salivary anti-microbial peptide with strong fungicidal properties.
Sequence:DSHAKRHHGYKRKFHEKHHSHRGY
MW:3036.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is derived from Histone H3 21-44 amino acids, and is usually used as a substrate for methylation assays. It has been used as a substrate for protein arginine methyltransferases
Sequence:ATKAARKSAPATGGVKKPHRYRPG
MW:2505.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

The P. falciparum circumsporozoite protein (PfCSP) is the most abundant antigen expressed on the surface of P. falciparum sporozoites. This pre-erythrocytic antigen contains a stretch of 6 highly conserved, immunodominant tetrapeptide repeats (NANP) in the middle, while its N- and C-terminal regions contain two crucial protective regions termed RI and RII-plus, respectively. Both play key roles during parasite invasion. PfCSP has been the main target antigen in the development of preerythrocytic malaria vaccines, including subunit proteins with adjuvants or attenuated viral platforms. Studies show that high titers of antibodies directed to PfCSP are believed to interrupt the invasion of hepatocytes by blood-borne sporozoites, thereby abrogating the development of blood-stage malaria.
Sequence:NANPNANPNANPNANPNANPNANPC
MW:2499.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Streptavidin, nonglycosylated, tetrameric protein, 55,000-dalton, with each subunit able to bind a single molecule of the vitamin biotin, purified from Streptomyces avidinii, Physical State: Lyophilized powder, Solvent System: water, Storage -20 deg C desiccated, Size: 5mg

Supplier: Anaspec Inc

This is amino acids 1 to 20 fragment of the histone H3. Comparison the acetylation efficiency of different substrates showed that this peptide corresponding to the N-terminal of H3 histone has nearly identical acetylation efficiency as the H4 peptides. Acetylation of histones is generally associated with active transcription, constitutes a post-translational mark recognized by specific chromatin factors, and has been shown in vitro to prevent salt-induced folding of nucleosome arrays. Multisubunit histone acetyltransferase (HAT) complexes recognize and perform efficient acetylation on nucleosome substrates.
Sequence:ARTKQTARKSTGGKAPRKQL
MW:2183.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 1-42.
Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Weight: 4514.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Temporin A is a highly hydrophobic antimicrobial peptide amide derived from the frog Rana temporaria. This antimicrobial peptide exerts its effect by inducing the migration of human monocytes, macrophages, and neutrophils, thus modulating the permeability of the microbial membrane to allow passage of various-sized molecules and exhibiting activity against gram-positive bacteria, particularly antibiotic-resistant gram-positive cocci. Temporin A activity is enhanced when used in combination with other antimicrobial agents.
Sequence:FLPLIGRVLSGIL-NH2
MW:1396.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Pep-1 is one of the synthetic cell-penetrating peptides (CPPs), which has been successfully used to deliver a variety of proteins and other biopharmaceutical macromolecules into cells in a non-disruptive way. It is a CPP with primary amphipathicity (i.e amphipathicity resulting from the amino acid sequence itself, not from the folding structure) that comprises a tryptophan-rich so-called ‘hydrophobic’ domain, a hydrophilic domain derived from an NLS (nuclear localization signal) of SV40 (simian virus 40) large T-antigen, and a spacer between them.
Sequence:KETWWETWWTEWSQPKKKRKV
MW:2848.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide corresponds to the GAP26 domain of the extracellular loop of the major vascular connexins (Cx37, Cx40), designated as 37,40Gap 26 according to Cx homology. It was used to investigate the role of gap junctions in the spread of endothelial hyperpolarizations evoked by cyclopiazonic acid (CPA) through the wall of the rodent iliac artery. The gap junction plaques constructed from Cx37 and Cx40 were abundant in the endothelium. This peptide provides inhibitory effects against subintimal hyperpolarization
Sequence:VCYDQAFPISHIR
MW:1548.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

This Gap 26 peptide is derived from the first extracellular loop sequence of connexin (Cx) 43. This short mimetic peptide reversibly inhibits the gap junction-dependent propagation of Ca2+ waves between tracheal airway epithelial cells.
Sequence:VCYDKSFPISHVR
MW:1550.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

β-galactosidase, encoded by the lacZ gene in E

Supplier: Anaspec Inc

Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature.
Sequence:YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)
MW:5729.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

QXL® 570 dyes are optimized quenchers for rhodamines (such as TAMRA, sulforhodamine B, ROX) and Cy3 fluorophores.

Supplier: Anaspec Inc

This peptide corresponds to human, bovine (119-126), mouse, rat (118-125) and Heparin-Binding Growth Factor 2 (118-125) residues of bFGF. It inhibits dimerization and activation of bFGF receptors.
Sequence:KRTGQYKL
MW:993.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is derived from the Neh2 domain of nuclear factor (erythroid-derived 2)-like 2, or Nrf2. Nrf2 is a bZIP transcription factor that regulates the expression of antioxidative and cytoprotective genes. The DxETGE motif of this peptide binds Keap1 Kelch adaptor protein and displaces Nrf2 from Keap1.
Sequence:LQLDEETGEFLPIQ
MW:1631.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Melittin, a 26-residue bee venom peptide, is known to induce murine antibodies specific for its hydrophilic C-terminus of residues 20 to 26 and T-cell responses specific for its hydrophobic mid-region (residue 11 to 19). This peptide is an anti-inflammatory agent, it inhibits the lyme disease spirochete.
Sequence:GIGAVLKVLTTGLPALISWIKRKRQQ-NH2
MW:2846.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a biotin labeled H3K9(Ac) Histone. H3K9(Ac) is highly localized to the 5’ region of transcription start sites in human genes. Localization of H3K9(Ac)  to the transcriptionally active 5’ region of human genes suggests this peptide is essential for transcription initiation and elongation.
Sequence:ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)-NH2
MW:2764.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This serine substituted PLP (139-151) causes severe, acute experimental allergic encephalomyelitis in SJL mice.
Sequence: HSLGKWLGHPDKF
MW: 1521.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

This is one of the cell-penetrating peptides (CPPs) derived from the human immunodeficient virus (HIV)-1 Tat protein residue 48-60. It has been used to deliver exogenous macromolecules into cells in a non-disruptive way.
Sequence: GRKKRRQRRRPPQ
MW: 1719 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

This is a fluorescent (HiLyte™ Fluor 488)-labeled Endothelin 1 (ET-1) peptide, Abs/Em=503/528 nm.
Sequence:HiLyte™ Fluor 488-CSCSSLMDKECVYFCHLDIIW (Disulfide Bridge: 1-15 and 3-11)
MW:2848.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

In one study where this peptide was labeled with 125I, it was found to bind specifically and with high affinity to alpha-v/beta-3 receptors on neovascular blood vessel sections of different major human cancers. The integrin alpha(IIb)beta(3)-specific cyclic hexapeptide contains an Arg-Gly-Asp (RGD) sequence.
Sequence:Cyclo(-RGDfK)
MW:603.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Protein conjugates prepared with HiLyte™ Fluor 488 dyes are far superior to conjugates of fluorescein derivatives such as FITC.