Order Entry
Puerto Rico
ContactUsLinkComponent
 

 

HiLyte™ Fluor 488 acid, SE fluorescent dye

Supplier: Anaspec Inc

HiLyte™ Fluor 488 acid, SE is an excellent amine-reactive fluorescent labeling dye that generates the protein conjugates far superior to those of fluorescein derivatives such as FITC.

Expand 2 Items
 

5-TAMRA Lysine

Supplier: Anaspec Inc

This product is a very useful building block and a good transglutaminase substrate.

Expand 1 Items
 

5(6)-Carboxyfluorescein

Supplier: Anaspec Inc

Although FITC reagents have been more often used to prepare fluoresceinated bioconjugates, the low stability of FITC bioconjugates makes some researchers use amine-reactive succinimidyl esters of carboxyfluorescein (commonly called FAM) in bioconjugations. FAM reagents give carboxamides that are more resistant to hydrolysis. We have shown that FAM reagents require less stringent reaction conditions and give better conjugation yields, and the resulted conjugates have superior stability. We noted that FITC labeled peptides tend to deteriorate more quickly than the corresponding FAM conjugates.

Expand 4 Items
 

MBP (68–86)

Supplier: Anaspec Inc

This peptide corresponds to the myelin basic protein (MBP) encephalitogenic epitope used to induce experimental autoimmune encephalomyelitis (EAE) in rats. It corresponds to amino acids 69-85 from guinea pig MBP.
Sequence:YGSLPQKSQRSQDENPV
MW:1933.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
 

[Lys(Ac)5/8/12/16]-Histone H4 (1-25)-GSGSK

Supplier: Anaspec Inc

This peptide is Histone H4 amino acid residues 1-25. It is acetylated at lysine 5/8/12/16.
Sequence:SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGSK
MW:2373.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
 

Human Beta-Amyloid (1-37)

Supplier: Anaspec Inc

Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Molecular Weight: 4074.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 2 Items
 

West Nile Virus Recombinant WNV NS3 Protease (from E. coli)

Supplier: Anaspec Inc

West Nile virus (WNV) is a member of the flavivirus genus, which contains many significant human pathogens including Dengue virus (Den), Japanese Encephalitits virus (JE), and Yellow Fever virus (YF). WNV is a small, enveloped virus with a single stranded, positive sense 11kb RNA genome, which encodes a polyprotein precursor. This polyprotein must be cleaved co- and post-translationally to produce ten functional proteins: three structural (C, prM and E) and 7 nonstructural (NS1, NS2A, NS2B, NS3, NS4A,NS4B and NS5). WNV NS3 protease is absolutely essential (along with viral-encoded cofactor NS2B) for post-translational cleavage and viral replication. As a result, this protease is a potential therapeutic target.

His-tagged recombinant WNV NS3 protease (residues 1 to 184) was expressed as a fusion protein with the cofactor NS2b (residues 49 to 96) and a linker sequence (GGGGSGGGG) in E. coli. The apparent Mr on SDS-PAGE is 32-kDa. Its activity can be measured by FRET peptides

Expand 2 Items
 

Human Aquaporin-2 (254-267), pSER261

Supplier: Anaspec Inc

This peptide is a fragment of the human aquaporin-2 (AQP2) phosphorylated at Ser261. Protein phosphorylation plays a key role in vasopressin signaling in renal-collecting duct. Phosphorylation at several AQP2 residues including Ser256 and Ser261, is altered in response to vasopressin. It is possible that both sites are involved in vasopressin-dependent AQP2 trafficking.
Sequence: RQSVELH-pS-PQSLPR
MW: 1713.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
 

Cyclin-dependent kinase 5 peptide

Supplier: Anaspec Inc

The native peptide PKTPKKAKKL (60026-1) is derived from histone H1 peptide sequence that is docked in the active site of cyclin-dependent kinase 5. It is an effective CDK5 substrate (Km = 40 µM).
Sequence:PKTPKKAKKL
MW:1138.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
 

Human Recombinant Tau (from E. coli) GST Tag

Supplier: Anaspec Inc

The sequence (Accession # AAC04279.1) corresponding to the full length human Tau-441 (2N4R isoform) protein along with GST tag at N-terminal was expressed in E. coli. The recombinant GST-Tau-441 protein was purified from bacterial lysate using proprietary method.
Microtubule associated protein (Tau) is found predominantly in the central neural system and its major function is to promote assembly and to stabilize neuronal microtubules. Six isoforms of Tau were identified in humans that are differentiated by the exclusion or inclusion of exons 2, 3, and 10. Tau-441 is the longest of Tau isoforms, consisting of 441 amino acids with molecular mass of 45.8 kDa. Under physiological conditions Tau can undergo abnormal phosphorylation, truncation, or other modifications that result in the protein detachment from microtubules. These modified Tau molecules can self-associate and form different types of aggregates including neurofibrillary tangles (NFTs) found in brains of patients with neurodegenerative diseases such as Alzheimer’s disease.

Expand 2 Items
 

Mouse;Rat Beta-Amyloid (1-40)

Supplier: Anaspec Inc

This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4233.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 2 Items
 

S6 Kinase Substrate (229-239)

Supplier: Anaspec Inc

This is a synthetic peptide substrate for S6 kinase shown to be phosphorylated by protein kinase c with phosphorylation site identified at Ser235.
Sequence:AKRRRLSSLRA
MW:1313.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 2 Items
 

Chicken OVA (323-339), FITC (Fluorescein Isothiocyanate)

Supplier: Anaspec Inc

This fluorescent (FITC)-labeled OVA (323 - 339) Peptide is an H-2b-restricted OVA class II epitope (Abs/Em = 493/522 nm).
Sequence: FITC-LC-ISQAVHAAHAEINEAGR
MW: 2276.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
 

GRGDS, Amide

Supplier: Anaspec Inc

This peptide inhibits the adhesion of human ovarian carcinoma OVCAR-3 cells to fibronectin, but not to laminin.
Sequence:GRGDS-NH2
MW:489.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
 

Human Fibrinogen Binding Inhibitor Peptide

Supplier: Anaspec Inc

The fibrinogen binding inhibitor peptide is important for platelet aggregation. The sequence is derived from the carboxy terminus of the gamma chain of fibrinogen (residues 400-411). This is considered one of the common ligands for glycoprotein (GPIIb-IIIa) recognition and binding.
Sequence:HHLGGAKQAGDV
MW:1189.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
 

CKS-17 (dimer)

Supplier: Anaspec Inc

A dimer of CKS-17 has a natural occurring cysteine at the carboxyl terminus (where it occurs in the retroviral peptides on which CKS-17 is based) and dimerization is accomplished by cysteine-disulfide linkage. CKS-17 is a synthetic retroviral envelope heptadecapeptide corresponding to a region highly conserved in retroviral transmembrane proteins such as pl5E. The CKS-17 peptide has been previously shown to inhibit monocyte superoxide production, natural killer cell activity, polyclonal B-cell activation, and monocyte-mediated killing by inactivation of interleukin-1.
Sequence:LQNRRGLDLLFLKEGGLC (dimer)
MW:4088.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
 

5(6)-Carboxyfluorescein diacetate NHS ester [CFSE (5(6)-CFDA SE)]

Supplier: Anaspec Inc

Reactive pH indicator for slightly acidic pH range

Expand 1 Items
 

Histone H3 (23-34)

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 23 to 34.
Sequence:KAARKSAPATGG
MW:1114.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
 

Human;Mouse;Rat Biotin-LC-Beta-Amyloid (15-25), Biotin

Supplier: Anaspec Inc

This is a biotinylated fragment of the human, mouse, rat ß-amyloid (15-25).
Sequence: Biotin-LC-QKLVFFAEDVG
Molecular Weight: 1591.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
 

6-HEX, SE

Supplier: Anaspec Inc

6-HEX, SE is a popular amino-reactive fluorescent probe that is widely used in nucleic acid sequencing and related research.

Expand 1 Items
 

SensoLyte® 520 Neprilysin Activity Assay Kit (Fluorimetric), AnaSpec

Supplier: Anaspec Inc

Neprilysin (NEP) is a transmembrane metallopeptidase normally expressed by a variety of tissues

Expand 1 Items
 

[Lys(Ac)5/8/12/16]-Histone H4 (1-21)-GGK,Biotin

Supplier: Anaspec Inc

This peptide is histone H4 (1-21), acetylated at lysine 5, 8, 12, and 16. It contains a C-terminal GG linker, followed by a biotinylated Lys. In general, histone H4 acetylation is associated with increased DNA replication during mitosis, although different combinations of acetylation at specific sites are selective for specific processes. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKV-GGK(Biotin)
MW:2728.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
 

Resorufin-β-D-galactopyranoside

Supplier: Anaspec Inc

Unlike FDG that requires a two-step hydrolysis to generate maximum fluorescence, resorufin β-D-galactopyranoside requires only a single-step hydrolysis reaction to attain full fluorescence. This substrate is especially useful for sensitive enzyme measurements in ELISAs. The relatively low pKa (~6.0) of resorufin (the enzymatic hydrolysis product of resorufin galactoside) with Ex/Em=573/585 nm permits continuous measurement of enzymatic activity. Resorufin galactoside has also been used to quantitate β-galactosidase activity in single yeast cells by flow cytometry and to detect immobilized β-galactosidase activity.

Expand 1 Items
 

Alpha9-Gliadin (57-68)

Supplier: Anaspec Inc

Gliadin is a gluten component. This peptide is derived from amino acid residues 57-68 of a9-gliadin and represents an immunodominant epitope that has been shown to elicit HLA-DQ2-restricted T-cell responses in celiac patients. This epitope is resistant to pancreatic proteolysis.
Sequence: QLQPFPQPQLPY
MW: 1455.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
 

Dihydroethidium

Supplier: Anaspec Inc

Bind to DNA/RNA (red fluorescence) upon oxidation. Store at -20C desiccated and protected from light

Expand 1 Items
 

SensoLyte® NADP/NADPH Assay Kit (Colorimetric), AnaSpec

Supplier: Anaspec Inc

Nicotinamide nucleotides are key players in the energy transforming and oxidation-reduction reactions of a cell

Expand 1 Items
 

Human Recombinant MOG (1-125) (from E. coli)

Supplier: Anaspec Inc

Myelin Oligodendrocyte Glycoprotein (MOG) is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system (CNS). Although MOG protein constitutes only 0.01-0.05% of the CNS myelin proteins, it was demonstrated that MOG protein is a crucial autoantigen for multiple sclerosis in humans and experimental autoimmune encephalomyelitis (EAE) in rodents and monkeys

The sequence (Accession # CAQ10087) corresponding to the extracellular domain of human MOG along with a 6x His tag was expressed in E. coli. The recombinant human MOG (H-rMOG) was purified from urea denatured bacterial lysate using immobilized metal affinity chromatography (IMAC). The molecular mass of the recombinant human MOG is 14.2 kDa

Expand 3 Items
 

C3a (70-77)

Supplier: Anaspec Inc

This octapeptide is a COOH-terminal fragment of the C3a anaphylatoxin peptide. On a molar basis, this peptide possesses 1-2% of the biological activities of C3a. It causes contraction of rodent ileum and uterus, release of vasoactive amines from rat mast cells, and increases vascular permeability in guinea pig and human skin. Both purified C3a and synthetic C3a (70-77), which retains partially the activity of anaphylatoxin, are shown to interact directly with human lymphocytes.
Sequence:ASHLGLAR
MW:823.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
 

AggreSure™ Human Beta-Amyloid (1-40)

Supplier: Anaspec Inc

AnaSpec's AggreSure™ beta-Amyloid (1-40) peptide is pretreated and tested for aggregation using AnaSpec's SensoLyte® ThT Aβ40 Aggregation kit (Cat# AS-72213).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
 

Histone H4 (1-23)-GSGSK, Biotin

Supplier: Anaspec Inc

This peptide consists of amino acids 1-23 of histone H4 attached at the C-terminal by a GSGS linker to biotinylated lysine. It is used as a substrate for histone acetyltransferase (HAT) assays. Biotinylation allows the peptide to be captured on streptavidin or agarose beads.
Sequence:SGRGKGGKGLGKGGAKRHRKVLR-GSGSK(Biotin)
MW:3003.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items