Order Entry
Puerto Rico
ContactUsLinkComponent
4987 results for "Anaspec Inc"

4987 Results for: "Anaspec Inc"

Sort By

Steroid Receptor Coactivator-1,Biotin

Supplier: Anaspec Inc

This is amino acids 676 to 700 fragment of steroid receptor co-activator (SRC1). This N-terminal biotinylated peptide is derived from the second LXXLL motif of SRC1. Co-activator proteins interact with nuclear receptors in a ligand-dependent manner and augment transcription. A short amphipathic beta-helical domain that includes this LXXLL motif serves as the interaction interface between the co-activator molecules and the ligand-dependent activation function (AF-2) located in the COOH-terminus of the nuclear receptor ligand-binding domain (LBD). Receptor binding domain of the co-activator SRC-1 is specifically recruited to the farnesoid X receptor (FXR) ligand-binding domain.
Sequence:Biotin-CPSSHSSLTERHKILHRLLQEGSPS
MW:3026.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Neuropeptide S

Supplier: Anaspec Inc

A neuropeptide that plays a role in arousal and fear responses.
Sequence:SFRNGVGTGMKKTSFQRAKS
MW:2187.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

SensoLyte® Homogeneous AMC Caspase-3/7 Assay Kit, AnaSpec Inc.

Supplier: Anaspec Inc

Central to the execution phase of apoptosis are the two closely related caspase-3 and caspase-7

Expand 1 Items
Loading...

Bovine Neurotensin

Supplier: Anaspec Inc

This 13 amino acid peptide was first isolated from bovine hypothalamus and was named from its neuronal localization. It was detected in the central nervous system (CNS) and peripheral tissues mainly in the gastrointestinal tract. This bioactive form of neurotensin post-translationally modified at a Glu residue was isolated from porcine intestine.
Sequence:Pyr-LYENKPRRPYIL
MW:1673 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 2 Items
Loading...

[Lys(Ac)27]-Histone H3 (21-43)-GGK(Biotin),Biotin

Supplier: Anaspec Inc

This peptide is Histone H3 (21-43) acetylated at lysine 27 with a C-terminal GG linker followed by a biotinylated lysine. The acetylation of histone H3 at lysine 27 is associated with many active mammalian genes. In Arabidopsis thaliana, the acetylated histone at lysine 27 is nontransposable element gene-specific. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAAR-K(Ac)-SAPATGGVKKPHRYRP-GGK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human [Asn23]-beta-Amyloid (1-40)

Supplier: Anaspec Inc

This peptide is naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor (APP). This mutation is associated with severe cerebral amyloid beta-protein angiopathy (CAA) in Iowa kindred. The affected individuals share a missense mutation in APP at position 694. This site corresponds to residue 23 of beta-amyloid peptide resulting in substitution of asparagine for aspartic acid.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...

SensoLyte® Anti-PLP (139-151) IgG Quantitative ELISA Kit (Mouse) (Colorimetric), AnaSpec

Supplier: Anaspec Inc

SensoLyte® Anti-PLP (139 - 151) IgG Quantitative ELISA Kit (Mouse) is optimized to detect mouse anti-PLP (139-151) IgG. This kit is useful to researchers who wish to determine the amount of anti-PLP (139-151) antibody present in biological samples, and can help provide information on the role it plays in the development and treatment of EAE, an animal model for MS pathogenesis. Wells are pre-coated with PLP (139-151) peptide and pre-blocked with BSA. The amount of anti-PLP (139-151) IgG in mouse serum or cerebrospinal fluid is quantified using ELISA (Abs=450 nm). Ample materials and reagents are provided to perform 96 assays.

Expand 1 Items
Loading...

SensoLyte® Thioflavin T β-Amyloid (1-42) Aggregation Kit, AnaSpec

Supplier: Anaspec Inc

The SensoLyte® ThT β-Amyloid (1-42) Aggregation kit provides a convenient and standard method to measure Aβ42 aggregation using Thioflavin T dye

Expand 1 Items
Loading...

Chicken OVA (257-264)

Supplier: Anaspec Inc

FILKSINE is the scrambled version of ovalbumin (OVA) peptide (257-264), SIINFEKL. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).
Sequence: FILKSINE
MW: 963.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...

Human Pancreatic Polypeptide, AnaSpec

Supplier: Anaspec Inc

Pancreatic Polypeptide (PP) is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas as a response to hypoglycemia. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal. PP modulates food intake, and is absent in children with Prader-Willi syndrome. Secretion of PP can be accomplished through electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and Gastrin appear to be involved in its secretion, while Ghrelin, Obestatin and Somatostatin are reported to inhibit its release. PP is related to Peptide YY and Neuropeptide Y (NPY).
Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
MW: 4181.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 2 Items
Loading...

Mouse Laminin alpha1 (2110-2127)

Supplier: Anaspec Inc

This peptide is derived from mouse laminin alpha1 amino acid residues 2110-2127. Cell matrix substrate constituted with this peptide can promote neurite outgrowth.
Sequence:CSRARKQAASIKVAVSADR-NH2
MW:2016.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

HIV TAT (47-57) Cys Peptide

Supplier: Anaspec Inc

This peptide corresponds to the protein transduction domain of the TAT protein. In some studies this has been used as a PKCε inhibitor peptide and also conjugated to PKC peptides and other molecules such as antisense oligomers for examining cell penetrating abilities.
Sequence: CYGRKKRRQRRR-NH2
MW: 1662 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 1 Items
Loading...

Human Beta-Amyloid (1-40), HiLyte™ Fluor 647

Supplier: Anaspec Inc

This is a fluorescent (HiLyte™ Fluor 647)-labeled ß-Amyloid peptide, Abs/Em = 649/674 nm.

Expand 1 Items
Loading...

Human STAL-2

Supplier: Anaspec Inc

This hexapeptide, referred to as STAL-2 or TRAP (Thrombin Receptor Activating Peptide), is a protease-activated receptor (PAR-1) agonist peptide.
Sequence:SFLLRN-NH2
MW:747.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

Human Ang II Biotin LC,Biotin

Supplier: Anaspec Inc

This octapeptide Angiotensin II, DRVYIHPF, is biotinylated on the N-terminus via an LC (long chain, also known as 6-Aminohexanoyl, 6-Aminocaproyl or Ahx) linker. It can be used in ELISA assay. Angiotensin II (Ang II) exerts a wide range of effects on the cardiovascular system. It is also implicated in the regulation of cell proliferation, fibrosis and apoptosis. Ang II is formed by cleavage of Ang I by the angiotensin-converting enzyme (ACE) or chymases. Human heart chymase, a chymotrypsin-like serine proteinase, hydrolyzes the Phe8-His9 bond to yield the octapeptide hormone angiotensin II and His-Leu.
Sequence: Biotin-LC-DRVYIHPF
MW: 1385.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 1 Items
Loading...

Influenza CEF Influenza

Supplier: Anaspec Inc

HLA-A*03 restricted epitope from influenza virus nucleoprotein (265-274).
Sequence: ILRGSVAHK
MW: 980.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 1 Items
Loading...

5-Carboxytetramethylrhodamine succinimidyl ester (5-TAMRA SE)

Supplier: Anaspec Inc

Although the mixed TAMRA isomers are predominantly used for labeling proteins, the single isomers are increasingly preferred for labeling peptides and nucleotides because they give better resolution in HPLC purification that is often required in the conjugation processes. 5-TAMRA is more often used than 6-TAMRA for labeling peptides and proteins. 6-TAMRA is predominately used for labeling nucleotides and sequencing nucleic acids.

Expand 2 Items
Loading...

SensoLyte® 520 ECEs Activity Assay Kit (Fluorimetric), AnaSpec

Supplier: Anaspec Inc

ECEs or Endothelin converting enzymes (ECE-1/ECE-2) are known as rate-limiting enzymes for the formation of the vasoconstrictor peptide endothelin-1 (ET-1) from its precursor proendothelin-1

Expand 1 Items
Loading...

Alpha-Gliadin (31-43)

Supplier: Anaspec Inc

This peptide is derived from gliadin wheat protein residues 31-43. It elicits an innate immune response by upregulating expression of interleukin (IL)-15 and cyclooxygenase (COX)-2. This peptide also promotes expression of CD25 on monocytes and macrophages, expression of CD83 on dendritic cells, and p38 MAP kinase activation. Treatment with this peptide allows immunodominant epitopes (57-68 and 62-75) to induce T-cell activation and enterocyte apoptosis.
Sequence: LGQQQPFPPQQPY
MW: 1527.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
Loading...

Tetramethylrhodamine methyl ester perchlorate (TMRM) mitochondria dye, suitable for fluorescence

Supplier: Anaspec Inc

Used for measuring membrane potential of mitochondria; Fluorescence is less dependent on dye location.

Expand 1 Items
Loading...

Human beta-CGRP

Supplier: Anaspec Inc

This 37-amino acid peptide is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular and nervous systems. β-CGRP contains a disulphide bridge at the N-terminus, a C-terminal phenylalanine amide important for immune recognition, and an a-helix between residues 8 and 18.
Sequence:ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
MW:3793.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

Kemptide

Supplier: Anaspec Inc

Kemptide is a phosphate acceptor peptide that serves as a synthetic substrate for PKA (Km = 16 µM). The corresponding fluorescent and biotinylated peptides are also proven to be good substrates for PKA.
Sequence:LRRASLG
MW:771.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 2 Items
Loading...

Prosaptide TX14(A) Peptide

Supplier: Anaspec Inc

This 14-mer prosaptide sequence is derived from the active neurotrophic region in the amino-terminal portion of the saposin C domain. Synthetic peptides derived from this region are biologically active and are named “prosaptides.” Prosaposin and prosaptides are active on a variety of neuronal cells, stimulating sulfatide synthesis and increasing sulfatide concentration in Schwann cells and oligodendrocytes. This indicates that prosaposin and prosaptides are trophic factors for myelin formation.
Sequence:TaLIDNNATEEILY
MW:1579.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 2 Items
Loading...

6-Carboxy-X-rhodamine succinimidyl ester (6-ROX SE)

Supplier: Anaspec Inc

6-ROX, SE is the other purified single isomer of 5(6)-ROX, SE. It appears that 5-ROX is more often used than 6-ROX for labeling peptides and proteins. 6-ROX is predominately used for labeling nucleotides and sequencing nucleic acids.

Expand 1 Items
Loading...

CSK tide, FAM (Carboxyfluorescein)

Supplier: Anaspec Inc

This is a FAM labeled peptide substrate (Abs/Em = 494/521 nm) for C-terminal Src kinase (Csk) and many other kinases such as Axl, cKit, ERBB4, Fes, Flt3, IGF-1 R, MET, MUSK, PYK2, Ret, TIE2, TrkA, VEGF-R1 and VEGF-R2.
Sequence:5-FAM-KKKKEEIYFFFG-NH2
MW:1921.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Biotin-LC-MBP Derivatized Peptide,Biotin

Supplier: Anaspec Inc

This peptide is a fragment of myelin basic protein (MBP), which corresponds to amino acids 88-102 in mouse, 88-104 in guinea pig and 89-105 in human. It is biotinylated in N-term, with a LC linker.
Sequence:Biotin-LC-FFKNIVTPRTPPPSQGK-NH2
MW:2252.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 2 Items
Loading...

Human GIP (3-42)

Supplier: Anaspec Inc

This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.
Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4759.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
Loading...

Bak BH3 peptide, TAMRA (5-Carboxytetramethylrhodamin)

Supplier: Anaspec Inc

This peptide is derived from the BH3 domain of Bak (Flu-BakBH3). It has high-affinity binding to a surface pocket of the Bcl-XL protein that is essential for its death antagonist function. This peptide is labeled with 5-TAMRA on the N-terminus, Abs/Em= 541/568
Sequence:5-TAMRA-GQVGRQLAIIGDDINR
MW:2137.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Fluorogenic DPPIV Substrate, AFC (Antibody-fluorophore conjugate)

Supplier: Anaspec Inc

This is a fluorescent peptide, Abs/Em=380/500. It is a substrate for dipeptidyl peptidase IV (DPP IV) and Xaa-Pro dipeptidase.
Sequence:AP-AFC
MW:397.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Bactenecin 2A

Supplier: Anaspec Inc

This peptide is Bac2A, a linear variant of the loop-shaped cationic antimicrobial peptide Bactenecin found in bovine neutrophils. The Cys disulfide bond-forming residues of Bactenecin is replaced with Ala in Bac2A, and is active against both gram-positive and gram-negative bacteria.
Sequence:RLARIVVIRVAR-NH2
MW:1420.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...
Sort By