4987 Results for: "Anaspec Inc"
Cytomegalovirus (CMV) Cytomegalovirus (CMV) Control Peptide Pool
Supplier: Anaspec Inc
These 5 Cytomegalovirus (CMV) peptides, at 0.25 mg each (total of 1.25 mg/vial), constitute part of the CEF control peptide pool (cat# AS-61036-025). Now available separately as CMV control peptide pool, Influenza control peptide pool (cat# AS-62340) and EBV control peptide pool (cat# AS-62341), these peptides have been used in the stimulation of IFNgamma release from CD8+ T cells in individuals with defined HLA types, these epitopes are useful in applications such as ELISPOT, intracellular cytokine and CTL assays. All peptides are provided as net weight based on peptide content.
Sequence:
MW:
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
flg22
Supplier: Anaspec Inc
This is 22 amino acids flagellin peptide known as flg2. It spans the core domain necessary for binding and biological activity in plant cells. This peptide spanning the 22 amino acids in the core of the conserved domain induces responses after treatment with fungal elicitors such as chitin fragments, xylanase, ergosterol, and high-mannose–type glycopeptides when applied in subnanomolar concentrations. Flagellin is the structural protein that forms the major portion of flagellar filaments. Flagellins from different bacterial species vary in their central part but show conservation of their N-terminal and C-terminal regions.
Sequence:QRLSTGSRINSAKDDAAGLQIA
MW:2272.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
4N1K, AnaSpec
Supplier: Anaspec Inc
4N1K is a cell-binding domain adhesive peptide. It has been identified as an IAP agonist. Integrin-associated protein (IAP) is important in host defense where it is required for integrin-dependent functions of polymorphonuclear leukocytes. IAP also appears to be important in modulating integrin function in other cells and in signal transduction upon ligand binding by certain integrins with which it associates.
Sequence:KRFYVVMWKK
MW:1384.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human Beta-Amyloid (11-42), HiLyte™ Fluor 488
Supplier: Anaspec Inc
This is amino acids 11 to 42 fragment of b-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm. Post-mortem Alzheimer’s diseased (AD) brain specimens reveal significant levels of this b -amyloid peptide within the insoluble amyloid pools. HiLyte™ Fluor 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42).
Sequence: HiLyte™ Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3692.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Expand 1 Items
Thrombin Substrate
Supplier: Anaspec Inc
This is a chromogenic substrate for thrombin, Abs=405 nm.
Sequence:f - Pip - R - pNA
MW:552.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Expand 1 Items
SAM PEP 1 Peptide, FAM (Carboxyfluorescein)
Supplier: Anaspec Inc
This FAM labeled peptide (Abs/Em = 494/521 nm) can be used as a substrate for 5-AMP-activated protein kinase (AMPK) in in vitro kinase assays.
Sequence:5-FAM-HMRSAMSGLHLVKRR
MW:2137.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
HIV Gp91 TAT Peptide 2
Supplier: Anaspec Inc
This peptide is composed of gp91phox sequence linked to the human immunodeficiency virus-tat peptide. The tat sequence facilitates the entry of this peptide into all cells. It is used as a peptide inhibitor for NADPH oxidase assembly. It is two amino acid residues shorter at the N-terminus compared with gp91 ds-tat.
Sequence: RKKRRQRRRCSTRIRRQL-NH2
MW: 2453 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Expand 1 Items
Human alpha1(I) Collagen (614-639) Peptide
Supplier: Anaspec Inc
This is a peptide inhibitor of collagen fibrillar matrix assembly.
Sequence:SAGFDFSFLPQPPQEKAHDGGRYYRA
MW:2942.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Magainin 1
Supplier: Anaspec Inc
Magainin 1, Purity: HPLC >/= to 95%, Molecular Weight: 2409.9, Sequence: GIGKFLHSAGKFGKAFVGEIMKS, Appearance: Lyophilized white powde, it is peptide antibiotics with antibacterial and antiparasitic activities, Storage: -20 deg C, Size: 0.5 mg
Expand 2 Items
Rat C-Peptide-2
Supplier: Anaspec Inc
This rat C-peptide-2 differs from the active human C-peptide by several amino acids, however conserved Glu at positions 3, 11, and 27 is essential for peptide activity. In rat medullary thick ascending limb, C-peptide stimulates Na+,K+-ATPase activity within a physiological concentration range. This effect is due to an increase in Na+,K+-ATPase turnover rate that is most likely mediated by protein kinase C-f phosphorylation of the Na+,K+-ATPase f-subunit.
Sequence: EVEDPQVAQLELGGGPGAGDLQTLALEVARQ
MW: 3161.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 1 Items
Bacillus anthracis Poly-gamma-D-Glutamic Acid
Supplier: Anaspec Inc
This peptide is a poly-gamma-D-glutamic acid (DPGA)10 construct that relates to the sequence of the Bacillus anthracis capsule which is composed of gamma DPGA. gamma DPGA is an essential virulence factor of B. anthracis. The capsule inhibits innate host defense through its antiphagocytic action. gamma DPGA is a poor immunogen, but when bound to a carrier protein, it elicits serum antibodies.
Expand 1 Items
[Lys(Ac)12]-Histone H4 (1-20)
Supplier: Anaspec Inc
This peptide is Histone 4 acetylated at lysine 12. Based on genome-wide localization studies, this peptide has been found to occupy promoter region at the transcription start sites, especially being associated with particular promoters that may drive high levels of mRNA transcripts stored in mature spermatozoa. Such observations have led to assumptions that H4K12Ac may be one of the epigenetic marks for developmentally important genes.
Sequence:SGRGKGGKGLG-K(Ac)-GGAKRHRK
MW:2034.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
[Lys(Me3)4]-Histone H3 (1-21)-GGK,Biotin
Supplier: Anaspec Inc
This peptide is a synthetic peptide corresponding to amino acids 1-21 of human histone H3. It is trimethylated at lysine-4 with a C-terminal Gly-Gly linker followed by a biotinylated Lys. The trimethylation of histone H3 at lysine 4 [H3K4(Me3)] shows cell state and lineage potential by differentiating genes that are expressed, poised for expression, or repressed. H3K4(Me3) also labels imprinting control regions.
Sequence:ART-K(Me3)-QTARKSTGGKAPRKQLA-GGK(Biotin)-NH2
MW:2765.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
[pSer10), Lys(Ac)14]-Histone H3 (1-21)-GGK,Biotin
Supplier: Anaspec Inc
This peptide is Histone H3 amino acid residues 1 to 21 phosphorylated at Ser-10 and acetylated at Lys-14 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARK-pS-TGG-K(Ac)-APRKQLA-GGK(Biotin)
MW:2845.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
HIV TAT-HA2 Fusion Peptide
Supplier: Anaspec Inc
This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.
Sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
MW: 3433 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Expand 1 Items
IRAK-1 (360-380) Peptide Substrate
Supplier: Anaspec Inc
This is a substrate peptide for Interleukin-1 Receptor-Associated Kinase (IRAK) 4, derived from the IRAK-1 activation loop peptide amino acids 360 to 380. This peptide sequence contains Ser-376, one of the primary phospho-acceptor residues of IRAK-1. IRAK-4 phosphorylates IRAK-1 as a key step in regulation of inflammatory signaling pathways.
Sequence:KKARFSRFAGSSPSQSSMVAR
MW:2285.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Smac/Diablo Peptide [AVPIAQKSE]
Supplier: Anaspec Inc
This is a 5-FAM-labeled Smac/Diablo Peptide (Abs/Em=492/518 nm), which serves as a Livin inhibitor. Livin prevents apoptosis and sensitizes Livin-expressing cells to chemotherapy. This peptide has the potential to be used as a therapeutic agent in cancer treatment.
Sequence:AVPIAQKSEK-K(5-FAM)-NH2
MW:1555.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Chicken OVA-Q4H7 Peptide
Supplier: Anaspec Inc
Q4H7 Peptide (SIIQFEHL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).
Sequence: SIIQFEHL
MW: 986.1 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Expand 1 Items
[pSer10]-Histone H3 (1-21)-GGK,Biotin
Supplier: Anaspec Inc
This peptide is Histone H3 amino acid residues 1 to 21. It is phosphorylated at Ser10 with a C-terminal GG linker followed by a biotinylated lysine. The phosphorylation of Histone H3 at Ser10 is a mitotic marker and is associated with chromosome condensation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARK-pS-TGGKAPRKQLA-GGK(Biotin)-NH2
MW:2802.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Chicken OVA-G4 Peptide
Supplier: Anaspec Inc
G4 peptide (SIIGFEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).
Sequence: SIIGFEKL
MW: 906.1 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Expand 1 Items
Human;Rat C5a Receptor Antagonist (linear)
Supplier: Anaspec Inc
This linear peptide is derived from the C-terminus of the chemokine, complement fragment 5 anaphylatoxin (C5a). This peptide functions to inhibit C5a binding and function at human and rat C5a receptors. C5a is crucial to triggering cellular immune responses and its overexpression is involved in arthritis, Alzheimer’s disease, cystic fibrosis, systemic lupus erythematosus, and other immunoinflammatory diseases
Sequence:FKP-(D-Cha)-Wr
MW:886.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
[Arg(Me1)17]-Histone H3 (1-21)-GGK,Biotin
Supplier: Anaspec Inc
This peptide is Histone H3 amino acid residues 1-21. It is monomethylated at arginine 17 with a C-terminal GG linker followed by a biotinylated lysine. The methylation of histone H3 at arginine 17 is linked with gene activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAP-R(Me1)-KQLA-GGK(Biotin)-NH2
MW:2736.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
[Lys(Me1)9]-Histone H3 (1-21)-GGK,Biotin
Supplier: Anaspec Inc
This peptide is Histone H3 amino acid residues 1-21. It is monomethylated at lysine 9 with a C-terminal GG linker followed by a biotinylated lysine. The monomethylation of histone H3 at lysine 9 is dynamically and sex-differentially regulated during meiotic prophase. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)-NH2
MW:2736.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Kallikrein 3 Substrate
Supplier: Anaspec Inc
Chromogenic substrate for Kallikrein 3, commonly known as prostate specific antigen (PSA)
Sequence:Suc-RPY-pNA
MW:654.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
520 MMP FRET Substrate III, QXL™ 520-FAM, AnaSpec
Supplier: Anaspec Inc
Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 8, 9, 12, 13 and 14 activities, Abs/Em = 494/521 nm.
Sequence:QXL™ 520-PLGC(Me)HAr-K(5-FAM)-NH2
MW:1743.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
ARP
Supplier: Anaspec Inc
Biotinylating reagent for carbohydrates and nucleic acids
Expand 1 Items
Rat Recombinant MOG (1-125) (from E. coli)
Supplier: Anaspec Inc
Myelin Oligodendrocyte Glycoprotein (MOG) is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system (CNS). Although MOG protein constitutes only 0.01-0.05% of the CNS myelin proteins, it was demonstrated that MOG protein is a crucial autoantigen for multiple sclerosis in humans and experimental autoimmune encephalomyelitis (EAE) in rodents and monkeys
The sequence (Accession #CAE84068) corresponding to the extracellular domain of rat MOG along with a 6x His tag was expressed in E. coli. The recombinant rat MOG (R-rMOG) was purified from urea denatured bacterial lysate using immobilized metal affinity chromatography (IMAC). The molecular mass of the recombinant rat MOG is 14.2 kDa.
Expand 3 Items
520 MMP FRET Substrate XI, QXL™ 520-FAM, AnaSpec
Supplier: Anaspec Inc
Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521 nm.
Sequence:5-FAM-P-Cha-G-Nva-HA-Dap(QXL™ 520)-NH2
MW:1567.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Crosstide Peptide, FAM (Carboxyfluorescein)
Supplier: Anaspec Inc
Crosstide is a peptide analog of glycogen synthase kinase-3 (GSK-3) that functions as a natural substrate for Akt/PKB. It displays similar specificities towards PKBα, PKBβ and PKBγ isoforms. It is also recognized by MAPKAP kinase-1 and p70S6K. The fluorescent and biotinlyated peptides demonstrate similar enzyme activities.
Expand 2 Items
T20
Supplier: Anaspec Inc
This 36-residue synthetic peptide strongly inhibits HIV-1 viral fusion with CD4 cells with an EC50 of 1 ng/ml.
It is a peptide mimetic of an essential region within the viral envelope glycoprotein gp41 that functions by blocking gp41 structural rearrangements at a transitional pre-fusion conformation.
Sequence:Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2
MW:4492 Da
% peak area by HPLC:95
Storage condition:-20° C