4987 Results for: "Anaspec Inc"

Supplier: Anaspec Inc

GST (Glutathione S-Transferase) enzymes, a family of isozymes plays a crucial role in body defense mechanisms against toxins and carcinogens

Supplier: Anaspec Inc

Glutathione (GSH) is an important antioxidant molecule that functions as a cofactor for a variety of enzymes and is involved in various biological processes

Supplier: Anaspec Inc

B-Phycoerythrin (B-PE), a fluorescent protein from phycobiliprotein family, is isolated from cyanobacteria and eukaryotic algae. SMCC activated B-PE is chemically modified with SMCC. SMCC reacts with the primary amine on B-PE and introduces maleimide groups to B-PE. These maleimide groups easily react with thiol groups of target protein without the need for any additional activation, resulting in convenient conjugation of B-PE with proteins. Its primary absorption peak is at 545 nm with secondary peak at 563 nm. B-PE and the closely related R-PE are the most intensely fluorescent phycobiliproteins having orange fluorescence. They are significantly brighter and more photostable than conventional organic fluorophores. B-PE conjugates have been widely used in applications such as flow cytometry and multi-color immunofluorescent staining.

Supplier: Anaspec Inc

A lipophilic membrane stain that diffuses laterally to stain the entire cell; Its fluorescence is significantly enhanced upon membrane incorporation.

Supplier: Anaspec Inc

MMP-1 (interstitial collagenase, fibroblast collagenase) is an extracellular protease

Supplier: Anaspec Inc

HIV protease (PR) is identified as an important drug-screening target for the design of selective acquired immunodeficiency syndrome (AIDS) therapeutics.

Supplier: Anaspec Inc

HCV protease is identified as an important drug-screening target.

Supplier: Anaspec Inc

5-FAM, SE is a single isomer. It is one of the most popular green fluorescent reagents used for labeling peptides, proteins and nucleotides. It has also been used to prepare various small fluorescent molecules.

Supplier: Anaspec Inc

ROX dyes have longer excitation and emission wavelengths than the other ‘conventional’ rhodamines. These dyes are used to label peptides, proteins, and other biological ligands. 5-ROX, 6-ROX and their mixture 5(6)-ROX are used to label biomolecules by EDC-mediated reactions.

Supplier: Anaspec Inc

This SensoLyte® high-sensitivity (2pg/mL) beta-Amyloid (1-40) Quantitative ELISA Kit (Mouse/Rat) provides a convenient and quantitative assay for determining mouse/rat beta-Amyloid (1-40) (Aβ40) amount in cell and tissue lysate as well as in body fluids

Supplier: Anaspec Inc

Calcein, AM is a cell-permeant and non-fluorescent compound that is widely used for determining cell viability

Supplier: Anaspec Inc

Chromogenic N-acetylgalactosaminidase substrate

Supplier: Anaspec Inc

HiLyte™ Fluor594 hydrazide is a carbonyl-reactive fluorescent labeling dye. It can be used for labeling glycoproteins such as HRP.

Supplier: Anaspec Inc

DABCYL acid is the abbreviation of 4-(dimethylaminoazo)benzene-4-carboxylic acid. In some literature, DABSYL (4-dimethylaminoazobenzene-4'-sulfonyl chloride) is misused as ‘DABCYL’. DABCYL is one of the most popular acceptors for developing FRET-based nucleic acid probes and protease substrates. DABCYL dyes are often paired with EDANS in FRET-based fluorescent probes.

Supplier: Anaspec Inc

Although DABCYL is one of the most popular acceptors for developing FRET-based nucleic acid probes and protease substrates, its extremely high hydrophobicity and resultant poor water solubility have limited its use in the development of sensitive fluorogenic FRET probes. DABCYL Plus™ is developed to address this limitation. DABCYL Plus™ retains spectral properties similar to those of DABCYL. This feature enables researchers to keep all assay settings similar to those of DABCYL’s probes. In addition, DABCYL Plus™ has much greater water solubility than DABCYL. We have used DABCYL Plus™ to develop various protease substrates. In some cases, it has demonstrated greatly improved enzyme performance.

Supplier: Anaspec Inc

Phthalaldehyde ≥95% (by HPLC), Ultra Pure Grade

Supplier: Anaspec Inc

B-Phycoerythrin (B-PE), a fluorescent protein from phycobiliprotein family, is isolated from cyanobacteria and eukaryotic algae. Its primary absorption peak is at 545 nm with a secondary peak at 563 nm. B-PE consists of a, b and g subunits and is present as (ab)6g. B-PE and the closely related R-PE are the most intensely fluorescent phycobiliproteins having orange fluorescence. They are significantly brighter and more photostable than conventional organic fluorophores. B-PE labeled streptavidin, primary and secondary antibodies have been widely used in applications such as flow cytometry and multi-color immunofluorescent staining.

Supplier: Anaspec Inc

Fluorogenic cytochrome P-450 substrate that generates red fluorescent product upon enzyme cleavag

Supplier: Anaspec Inc

Environment-sensitive dye for studying membranes and structures of proteins.

Supplier: Anaspec Inc

This is amino acids 1 to 42 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13. Residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4418 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker followed by a biotinylated lysine. It is di-methylated at lysine 20.
Sequence:Ac-KGLGKGGAKRHR-K(Me2)-VLRDNIQGITWG-K(biotin)
MW:3170.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Penetratin-Arg is a cell-penetrating peptide (CPP) that is derived from the 3rd helix of Drosophila Antennapedia homeodomain protein. Penetratin-Arg is the same as Penetratin except that Lysine residues were substituted with Arginines. It forms an alpha-helix structure in lipid environment and can permeate cell membrane at low micromolar concentration without significantly affecting membrane. CPP can be conjugated with large molecules and used as a drug delivery vehicle. R
Sequence:RQIRIWFQNRRMRWRR
MW:2358.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is histone H4 (1-25) with acetylation at Lys5. It is biotinylated through a C-terminal GSGSK linker. Acetylation at Lys5 plays a role in histone deposition and transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRG-K(Ac)-GGKGLGKGGAKRHRKVLRDN-GSGSK(Biotin)
MW:3274.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This heparin-binding peptide is derived from vitronectin (367-378). Vitronectin is a glycoprotein found in monomer form in the blood and oligomer form in the extraceullular matrix. This peptide has been shown to promote the adhesion and undifferentiated growth of human pluripotent stem cells.
Sequence:GKKQRFRHRNRKG
MW:1668 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

HLA A2-restricted epitope from influenza matrix protein (58-66).
Sequence: GILGFVFTL
MW: 966.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is a selective PAR4 antagonist which inhibits thrombin- and PAR-4 agonist induced rat platelet aggregation.
Sequence: trans - Cinnamoyl - YPGKF - NH2
MW: 739.8 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

This FRET substrate peptide for Plasmepsin V (PMV) is derived from the conserved Plasmodium Export Element (PEXEL) motif of Histidine-Rich Protein II (HRPII). PMV is an ER aspartic protease that recognizes and cleaves the RXL sequence within the PEXEL motif of proteins exported by human malaria parasite Plasmodium falciparum, allowing them to translocate into host erythrocytes.
Sequence:Dabcyl-LNKRLLHETQ-EDANS
MW:1751.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a myristoylated form of Autocamtide-3-Derived Inhibitory Peptide (AC3-I), a highly specific inhibitor of Calmodulin-Dependent Protein Kinase ll (CaMKII) that is resistant to proteolysis. AC3-I is derived from Autocamtide-3, a substrate for CaMKII, with the Thr-9 phosphorylation site substituted with Ala.
Sequence:Myr-KKALHRQEAVDAL
MW:1689.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Cleavage of this FRET substrate generates the fluorescent Mca signal that is monitored fluorimetrically at 393 nm, with excitation at 325 nm. A highly fluorescent substrate for caspase 1.
Sequence: Mca-YVADAPK(Dnp)
MW: 1145.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 3, 7, 8, 9, 12, and 13 activities, Abs/Em = 494/521 nm.
Sequence:QXL™ 520 -γ-Abu-P-Cha-Abu-Smc-HA-Dab(5-FAM)-AK-NH2 (Smc=S-Methyl-L-cysteine)
MW:1913.1 Da
% peak area by HPLC:95
Storage condition:-20° C