4987 Results for: "Anaspec Inc"

Supplier: Anaspec Inc

This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death
Sequence:GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
MW:4103.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is derived from amino acid residues 372-389 of human p53 tumor suppressor protein and is acetylated at Lys382. It is biotinylated at its N-terminus through a 6-carbon LC linker. Activated p53 functions to induce cell cycle arrest and apoptosis in response to signals such as DNA damage. Acetylation of p53 reduces ubiquitination by MDM2 and increases p53 half-life in vivo.
Sequence:Biotin-LC-KKGQSTSRHK-K(Ac)-LMFKTEG
MW:2473 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This sequence is OVA (ovalbumin) peptide residues 257 to 280, also known as OT-II (OVA-specific T-cell receptor) peptide, the core H2b-restricted class II MHC epitope.
Sequence: AAHAEINEA
MW: 925 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is a HCV protease substrate incorporating an ester bond between residues P1 and P1. Due to ready transesterification of the scissile bond to the acyl-enzyme intermediate, this substrate shows very high kcat/Km values, enabling detection of activity with subnanomolar nonstructural protein 3 (NS3 protease) concentrations. It is widely used for the continuous assay of NS3 protease activity. Substrate cleavage is proportional to the enzyme concentration with a detection limit for NS3 between 1 nM and 250 pM. Upon cleavage of this substrate, fluorescence can be monitored at Abs/Em = 355/500 nm.

Supplier: Anaspec Inc

This is a peptide derived from the pseudosubstrate regulatory domain of PKC α residues (19-31) with alanine being replaced with serine at position 25.
Sequence:K(Biotin)-RFARKGSLRQKNV
MW:1914.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone 2B amino acid residues 21 to 41 with a C-terminal GG linker followed by a biotinylated lysine.
Sequence:AQKKDGKKRKRSRKESYSIYV-GGK(Biotin)
MW:3024.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 31 to 41 mono-methylated at Lys-36.
Sequence:STGGV-K(Me1)-KPHRY
MW:1243.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 23 to 34 di-methylated at Lys-27.
Sequence:KAAR-K(Me2)-SAPATGG
MW:1142.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide substrate for many protein kinases, such as Blk, BTK, cKit, EPHA1, EPHB2, EPHB3, ERBB4, FAK, Flt3, IGF-1R, ITK, Lck, MET, MUSK, Ret, Src, TIE2, TrkB, VEGF-R1 (Flt-1) and VEGF-R2 (KDR) is biotinylated on the N-terminus.
Sequence:Biotin-GEEPLYWSFPAKKK-NH2
MW:1905.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is peptide substrate for many protein kinases, such as Blk, BTK, cKit, EPHA1, EPHB2, EPHB3, ERBB4, FAK, Flt3, IGF-1R, ITK, Lck, MET, MUSK, Ret, Src, TIE2, TrkB, VEGF-R1 (Flt-1) and VEGF-R2 (KDR).
Sequence:GEEPLYWSFPAKKK-NH2
MW:1678 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This GRG containing peptide is amino acids 1 to 20 fragment of histone 4. It is a substrate for human protein-arginine methyltransferase 7 (PRMT7), a type II methyltransferase capable of producing symmetrical dimethyl arginine (sDMA) modifications in proteins.
Sequence:SGRGKGGKGLGKGGAKRHRK-NH2
MW:1991.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a 5-FAM-labeled cylic RGDyK peptide. RGD peptides serve as ligands for av-integrin and inhibit angiogenesis, induce endothelial apoptosis, decrease tumor growth, and reduce spread of metastasis.
Sequence:Cyclo[-RGDy-K(5-FAM)]
MW:978 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is amino acid sequence of rat C-peptide-1. C-peptide binds specifically to cell surfaces, probably to a G protein-coupled surface receptor, with subsequent activation of Ca2+-dependent intracellular signaling pathways. It also stimulates Na+-K+-ATPase and endothelial nitric oxide synthase activities. Rat C-peptide was found to diminish glucose-stimulated insulin release in rats both in vivo and in vitro.
Sequence: EVEDPQVPQLELGGGPEAGDLQTLALEVARQ
MW: 3259.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
Sequence:5-FAM-RQIKIWFQNRRMKWKK-NH2
MW:2604.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This Ghrelin peptide is biotinylated at the peptide N-terminus. Ghrelin is an appetite stimulating peptide hormone secreted by stomach P/D1-type cells in humans and circulates in the bloodstream during fasting conditions.  Enzymatically n-octanoylated Serine3 of this 28-amino acid Ghrelin is the endogenous ligand specific for growth hormone secretagogue receptor 1a (GHSR1a). The GHSR1a receptor appears to be dedicated to Ghrelin and is widely expressed in different tissues. 
Sequence: Biotin-GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR
MW: 3597.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

[125I]-(Pyr1)Apelin-13 binds with high affinity and selectivity to human cardiac tissue.
Sequence:Pyr-RPRLSHKGPMPF-OH
MW:1533.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

Full-length Recombinant human alpha-synuclein (GenBank Accession # NP_000336) was expressed in E. coli., and purified from bacterial lysate using proprietary method. Endotoxin was further removed by proprietary technique.
α-Synuclein is a major component of Lewy bodies in the affected neurons in Parkinson's disease. This protein has a mass of 14.5 kDa (140 amino acids long) and consists of a conserved degenerative amino-terminal domain and an acidic carboxyl-terminal with higher sequence divergence. α-Synuclein is predominantly expressed in brain, specifically in cerebellum, thalamus, neocortex, hippocampus, and striatum regions. Other tissues express α-Synuclein at very low levels. The physiological role of α-synuclein is not yet well understood. However, the presence of imperfect KTKEGV lipid interacting repeats suggests that it may be involved in synaptic vesicle homeostasis.

Supplier: Anaspec Inc

This is a fluorescent (FITC)-labeled Erythropoietin (EPO)-mimetic peptide (EMP17), Abs/Em=494/520 nm. Erythropoietin (EPO) is the hormone involved in red blood cell production, which activates its receptor by binding to the receptor's extracellular domain and presumably dimerizing two receptor monomers to initiate signal transduction. EMP contains two potentially reactive amines, one at the amino terminus of the peptide and one in the side chain of the single lysine within the peptide sequence.
Sequence: FITC-LC-TYSCHFGPLTWVCKPQGG
MW: 2483.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

Green fluorescent biotin used for studying avidin binding

Supplier: Anaspec Inc

Peptide sequence KVEKIGEGTYGVVYK is derived from the amino acid residues CDC26-20. It is considered to be a generic substrate for various TPKs.
Sequence:KVEKIGEGTYGVVYK
MW:1669.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This 15-mer peptide is fragment of (CFP)10 protein, which is secreted from mycobacterium tuberculosis 10-kDa culture filtrate stimulate IFN-gamma; production and CTL activity by CD4+ and CD8+ cells, from persons expressing a spectrum of MHC molecules. This peptide is an excellent candidate for inclusion in a subunit antituberculosis vaccine.
Sequence:EISTNIRQAGVQYSR
MW:1721.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens.
Sequence:AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
MW:5999.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Uroguanylin is a natriuretic peptide, a hormone that regulates sodium excretion by the kidney when excess NaCl is consumed. Uroguanylin and guanylin are related peptides that activate common guanylate cyclase signaling molecules in the intestine and kidney. Uroguanylin was isolated from urine and duodenum but was not detected in extracts from the colon of rats.
Sequence:TDECELCINVACTGC (Disulfide bonds between Cys4-Cys12 and Cys7-Cys15)
MW:1569.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is MHC class II antigen E alpha
Sequence:ASFEAQGALANIAVDKA
MW:1675.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is amino acids 48 to 57 fragment of TAT with an additional cysteine residue at the N-terminus. This peptide contains the protein transduction domain (PTD) of the HIV Tat protein that inhibits HSV-1 entry. The addition of a cysteine residue to the N-terminus of the Tat-PTD (Tat-C peptide) improves the antiviral activity against HSV-1 and HSV-2. Tat-C acts extracellularly, blocking entry of adsorbed virus immediately without eluting virions.
Sequence: CGRKKRRQRRR
MW: 1499.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.
Sequence: YGRKKRRQRRRAKEGANVAG
MW: 2357.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is a fusion of A208, derived from murine laminin a1, and the active site of fibronectin (GRGDS), with a glycine spacer. This peptide forms amyloid-like fibrils and promotes formation of actin stress fibers that mediate fibroblast cell attachment, offering it potential as a bioadhesive for tissue regeneration and engineering. FN-A208 interacts with IKVAV receptors and integrins. Its activity is disrupted by the presence of EDTA.
Sequence:GRGDSGAASIKVAVSADR
MW:1716.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is of Histone H4 (1-23) biotinylated through a GGK linker on the C-terminus. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLGKGGAKRHRKVLR-GGK(Biotin)-NH2
MW:2828.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This human Angiotensin I (Ang I) sequence also corresponds to horse, sheep, pig, and rat Ang I. Ang I is cleaved to Ang II by the angiotensin-converting enzyme (ACE). There is also evidence for non-angiotensin-converting enzyme-dependent conversion of Ang I to Ang II. Human chymase efficiently converts the 10-mer Ang I to the 8-mer hormone Ang II by splitting the Phe8-His9 bond in Ang I.
Sequence: DRVYIHPFHL
MW: 1296.5 Da
% Peak area by HPLC: 95
Storage condition: -20°C