4987 Results for: "Anaspec Inc"

Supplier: Anaspec Inc

This Histone 4 peptide is acetylated at lysine 16. Lysine 16 of H4 appears to be a unique target for acetylation. Studies in yeast clearly indicate that acetylation of H4 lysine 16 is an independent specific function in relation to gene transcription when compared to other histone acetylation sites. It was also observed that a human histone acetyltransferase complex showed strong specificity for H4K16 in chromatin and, RNAi-mediated knockdown experiments revealed that it is responsible for the majority of H4 acetylation at lysine 16 in the cell.
Sequence:SGRGKGGKGLGKGGA-K(Ac)-RHRK
MW:2034.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

ClearPoint™ beta-Amyloid (1-40) is a heavy-isotope labeled peptide. All the Arginine and Lysines have universally labeled 13C and 15N.
Sequence: DAEF-R*-HDSGYEVHHQ-K*-LVFFAEDVGSN-K*-GAIIGLMVGGVV [R*=R(U-13C6, U-15N4) & K*=K(U-13C6, U-15N2)]
Molecular Weight: 4355.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is Histone H3 acetylated at lysine 14. Histone lysine aetylation is known to play an important role in chromatin-directed gene transcription. A bromodomain 2 of polybromo (a chromatin remodelling protein) preferentially recognizes acetylated lysine of H3.
Sequence:ARTKQTARKSTGG-K(Ac)-APRKQ
MW:2112.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is beta-amyloid (1-42) with substitution of Ser26 to Cys. This peptide has been used in a number of fluorescent tagged experiments and suited for fluorescent probe labeling.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA
MW: 4530.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is a histone H3 trimethylated at lysine 4 and is associated with transcription, specifically marking the transcription start site of actively transcribed genes. This peptide can be demethylated by Jumonji AT-rich interactive domanin 1 (JARID1) or by lysine demethylase 5 (KDM5) family of lysine demethylases.
Sequence: ART-K(Me3)-QTARKSTGGKAPRKQLA
MW: 2296.6 Da
% peak area by HPLC: 95
Storage condition: -20 °C

Supplier: Anaspec Inc

This peptide is a scrambled version of the Gap 27 domain of Connexin.
Sequence:REKIITSFIPT
MW:1304.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

The is a reverse sequence of LL-37 used in control experiments.
Sequence: SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is the e-PKC specific activator, it also activates MARCKS phosphorylation in wild type cells, and has no effect on MARCKS phosphorylation in the cells derived from knockout mice.
Sequence:HDAPIGYD
MW:886.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin K is the lysosomal cysteine protease involved in bone remodeling and resorption. It has potential as a drug target in autoimmune diseases and osteoporosis.
This FRET peptide can be used to monitor selectively cathepsin K activity in physiological fluids and cell lysates. Abz-HPGGPQ-EDDnp [where Abz represents o-aminobenzoic acid and EDDnp represents N -(2,4-dinitrophenyl)-ethylenediamine], a substrate initially developed for trypanosomal enzymes, is efficiently cleaved at the Gly-Gly bond by cathepsin K. This peptide is resistant to hydrolysis by cathepsins B, F, H, L, S and V, Ex/Em=340 nm/420 nm.
Sequence:Abz-HPGGPQ-EDDnp
MW:920 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 (21-44) with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2
MW:2932.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is the beta-Amyloid peptide, residues 1 to 16 labeled with HiLyte™ Fluor 488 on the Lys16, Abs/Em =501/527.
Sequence: DAEFRHDSGYEVHHQ-K(HiLyte™ Fluor 488)
Molecular Weight: 2311.4 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This synthetic peptide corresponds to amino acids 20 to 42 of b-Amyloid protein.
Sequence: FAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 2217.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This short synthetic peptide facilitates efficient transdermal protein drug delivery through intact skin. Co-administration of the peptide and insulin to the abdominal skin of diabetic rats results in elevated systemic levels of insulin and suppresses serum glucose levels. This peptide creates a transient opening in the skin barrier to enable macromolecular drugs to reach systemic circulation.
Sequence:ACSSSPSKHCG
MW:1063.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This RGD-containing sequence is integrin-binding site. RGD peptides are found in both extracellular matrix (ECM) (e.g., collagen, osteopontin, fibronectin, and vitronectin) and non-ECM proteins (e.g., disintegrins). RGD-containing peptides are recognized by several integrins. This peptide targets both alphavbeta3 and alpha5beta1 integrins. Interaction of the RGDN sequence with endothelial alpha5beta1 integrin causes endothelin-mediated arteriolar vasoconstriction. This peptide influences the IkappaB kinase (IKK)/nuclear factor-kappaB (NF-kappaB) activation. It also controls the cardiac contractile function.
Sequence:GRGDNP
MW:614.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Sequence:KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
MW:3616.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

An H-2Db restricted epitope, this peptide is amino acids 61 to 80 fragment of the lymphocytic choriomeningitis virus (LCMV) pre-glycoprotein polyprotein GP complex. LCMV has been routinely used for the study of adaptive immune responses to viral infection.
Sequence:GLNGPDIYKGVYQFKSVEFD
MW:2276.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a Histone 3 peptide trimethylated at lysine 36. It's role has been indicative of defining exons, as certain nucleosome-enriched exons are observed to be enriched in some histone modifications. It is belived that this pattern of modification as seen with this H3K36me3 peptide, influences alternative splicing, perhaps by signaling effector proteins to mark particular exons for inclusion in the final transcript as they exit the RNA Polymerase II complex. It has also been shown in yeast that H3K36me3 gets deposited on histones as they are displaced by RNA polymerase II (RNAPII) during transcription. H3K36me3 then serves as a mark for HDACs to bind and deacetylate the histones.
Sequence:ATKAARKSAPATGGV-K(Me3)-KPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Staphylococcal Enterotoxin B domain (SEB) amino acid residue 163-172. This peptide sequence is highly conserved. It has been shown to inhibit transcytosis of multiple staphylococcal enterotoxins, SEA, SEE, and TSST-1.
Sequence:KKKVTAQELD
MW:1159.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Calpains are a family of intracellular Ca2+ dependent cysteine proteases. They respond to Ca2+ signals by cleaving many specific proteins, thereby irreversibly modifying their function(s). They are implicated in a variety of Ca2+ regulated cellular processes as well as various pathological phenomena, such as ischemic injury, muscular dystrophy, diabetes, cataract, atherosclerosis, Alzheimer’s disease, and cancer. Calpains represent potential therapeutic targets for drug discovery.
This 7-amino-4-methylcoumarin (AMC) labeled peptide is widely used as a fluorogenic substrate for 20S proteasome, calpains and other chymotrypsin-like proteases. Cleavage of this AMC peptide by the enzymes generates strongly fluorescent AMC that is monitored fluorimetrically at Abs/Em=353/442 nm.
Sequence:Suc-LLVY-AMC
MW:763.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is fluorescent GLP-1 labeled at the peptide C-terminus with FAM, Abs/Em=494/521 nm. In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36)-and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 4469.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

Aß (12–28) residues are the binding site for apolipoprotein E (apoE) on Aß. This sequence encompasses a hydrophobic domain (residues 14–21) and a ß-turn (residues 22–28) which place two hydrophobic domains of Aß 14 to 21 and 29 to 40/42 opposite each other, allowing for the assembly of Aß peptides into fibrils. The secondary structure of Aß (12- 28), a neutral peptide, is dominated by a-helix and random coil.
equence: VHHQKLVFFAEDVGSNK
Molecular Weight: 1955.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This FRET peptide is a specific substrate for renin. This renin peptide substrate may be used for screening of renin inhibitors. In the FRET peptide, the fluorescence of 5-FAM is quenched by QXL® 520. Upon cleavage into two separate fragments by renin, the fluorescence of 5-FAM is recovered, and can be monitored at excitation/emission = 490/520 nm. This substrate is employed in the SensoLyte® 520 Renin Assay Kit, cat # AS-72040 from AnaSpec.
MW: 2000 - 2200 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

DABCYL-GABA-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS is also called HIV protease substrate I in some literature. It is widely used for the continuous assay for HIV protease activity. The 11-kD protease (PR) encoded by the human immunodeficiency virus 1 (HIV-1) is essential for the correct processing of viral polyproteins and the maturation of infectious virus, and is therefore a target for the design of selective acquired immunodeficiency syndrome (AIDS) therapeutics. The FRET-based fluorogenic substrate is derived from a natural processing site for HIV-1 PR. Incubation of recombinant HIV-1 PR with the fluorogenic substrate resulted in specific cleavage at the Tyr-Pro bond and a time-dependent increase in fluorescence intensity that is linearly related to the extent of substrate hydrolysis. The fluorescence quantum yields of the HIV-1 PR substrate in the FRET assay increased by 40.0- and 34.4-fold, respectively, per mole of substrate cleaved. Because of its simplicity and precision in the determination of reaction rates required for kinetic analysis, this substrate offers many advantages over the commonly used HPLC or electrophoresis-based assays for peptide substrate hydrolysis by retroviral PRs. Abs/Em = 340nm/490nm.
Sequence:DABCYL-GABA-SQNYPIVQ-EDANS
MW:1532.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide, Exendin-4, has a biotin on the N-terminus. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: Biotin-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4412.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This is histone H3 (1-21) dimethylated at Lys9. Methylation of Lys 9 is associated with transcriptionally silent chromatin. Histone H3 mono- and dimethylated at Lys 9 localize specifically to silent domains within euchromatin while histone H3 trimethylated at this residue localizes to pericentric heterochromatin.
Sequence:ARTKQTAR-K(Me2)-STGGKAPRKQLA
MW:2282.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a PUMA (p53 upregulated modulator of apoptosis) BH3 domain peptide. PUMA together with Bcl-xL, and cytoplasmic p53 coordinate p53 functions. PUMA proteins bind Bcl-2, localize to the mitochondria, and induce cytochrome C release and apoptosis in response to p53. PUMA may be a direct mediator of p53-induced apoptosis.
Sequence:EEQWAREIGAQLRRMADDLNAQYER
MW:3049.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4983.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This is a class II (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin presented by the class II MHC molecule, H-2Kb. It is fluorescently labeled with 5-TAMRA, Abs/Em = 541/565 nm.
Sequence: 5-TAMRA-ISQAVHAAHAEINEAGR
MW: 2186.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is a substrate for Jak3. It may be used used in kinase assays. Jak3tide contains the phosphorylation site at Tyr7.
Sequence:GGEEEEYFELVKKKK
MW:1813 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Bactenecin is a 12-amino acid cationic antimicrobial peptide from bovine neutrophils.
Sequence:RLCRIVVIRVCR (Disulfide bridge: 3-11)
MW:1483.9 Da
% peak area by HPLC:95
Storage condition:-20° C