4987 Results for: "Anaspec Inc"

Supplier: Anaspec Inc

This peptide is derived from tyrosinase-related protein 2 (TRP2) residues 181-188, and has been identified as the primary epitope of TRP2 recognized by anti-B16 melanoma cytotoxic T lymphocytes (CTLs).
Sequence:VYDFFVWL
MW:1088.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a scrambled sequence of the g-fibrinogen amino acids 377 to 395. The original fibrinogen-derived inhibitory peptide attenuates microglia activation and suppresses relapsing paralysis in multiple sclerosis (MS). This scrambled peptide fails to produce these functions.
Sequence:KMMISYTFPIERTGLISNK
MW:2229.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

This is a peptide substrate for polypeptide N-acetylgalactosaminyltransferase (polypeptide GalNAc-T).
Sequence:PTTDSTTPAPTTK
MW:1317.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Indolicidin, a member of the cathelicidin protein family, is a 13-residue cationic, antimicrobial peptide-amide isolated from the cytoplasmic granules of bovine neutrophils. Indolicidin is microbicidal in-vitro against gram-positive and gram-negative bacteria, fungi, protozoa, and human immunodeficiency virus (HIV-1).
Sequence:ILPWKWPWWPWRR-NH2
MW:1906.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

HiLyte™ Fluor 555 acid, SE is an excellent amine-reactive fluorescent labeling dye that generates the protein conjugates that are only slightly red-shifted compared to those of Cy3 dyes, resulting in an optimal match to filters designed for Cy3 dyes.

Supplier: Anaspec Inc

This is the most characterized fragment of the HIV transactivator protein (TAT). This arginine-rich TAT peptide penetrates plasma membrane directly, but not through endocytosis.
Sequence: YGRKKRRQRRR
MW: 1559.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

(Arg)9 is a cell-permeable peptide used for drug delivery.It can traverse the plasma membrane of eukaryotic cells. This is a fluorescent (FAM)-labeled cell permeable peptide, Abs/Em = 494/521 nm.
Sequence:FAM-RRRRRRRRR
MW:1782 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Cell-permeable substrate for fluorimetric detection of oxidases (including peroxidase)

Supplier: Anaspec Inc

Type II casein kinase (CK-2) is unique among the protein kinases since it can use ATP as well as GTP as a phosphoryl donor. It is extremely sensitive to heparin inhibition and can be activated by polyamines and basic polypeptides. This peptide contains the consensus phosphorylation sequence for CK2 and can be used as the substrate for CK2 a-subunit.
Sequence:RRRDDDSDDD
MW:1264.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is derived from the tumor suppressor p53 mutant with the acetylated Lys on the side chain.
Sequence:KKGQSTSRHK-K(Ac)-LMFKTEG
MW:2133.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a peptide substrate that is phosphorylated by Serine/Threonine kinase 11 (STK11), also known as LKB1. LKBtide is derived from sucrose non-fermenting 1 (SNF1) protein kinase, which is normally activated by the LKB1/AMP-activated protein kinase (AMPK) signaling pathway.
Sequence:LSNLYHQGKFLQTFCGSPLYRRR
MW:2785.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide has an optimized sequence for MMP-7, with the cleavage occuring at the Ala-Leu bond. The substrate is used for high throughput screening of MMP-7 inhibitors. Abs/Em = 340/490 nm.
Sequence:DABCYL-RPLALWRS-EDANS
MW:1497.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a short fragment of the b-Amyloid peptide containing two aromatic phenylalanine residues. Short peptide models have provided novel insight into the mechanistic issues of amyloid formation. This heptapeptide fragment has the capacity of forming typical amyloid fibrils in vitro. Aromatic interactions are important in many cases of amyloid formation.
Sequence: KLVFFAE
Molecular Weight: 853 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Big Endothelin-1 (1-38) is precursor of endothelin 1. Big endothelin-1 is cleaved to yield endothelin-1 via the activity of an endothelin-converting enzyme (ECE). Big Endothelin-1 can be hydrolyzed by chymase to generate endothelin 1 (1-21) in vitro. Endothelins are endothelium-derived vasoconstrictor peptides.
Sequence:CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11)
MW:4283 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

QXL® 490 dyes are the optimized quenchers for EDANS, AMCA and most coumarin fluorophores.

Supplier: Anaspec Inc

The TCR transgenic model (BDC2.5) mimitope was used in type 1 diabetes (T1D) study. T1D is an autoimmune disease in which T cells mediate damage to pancreatic islet beta cells. T1D is caused by autoreactive T cell destruction of insulin-producing cells. BDC2.5 mimotope was utilized to support the study on antigen presentation of antigenic peptides to islet autoantigen-specific T cells.
Sequence: RTRPLWVRME
MW: 1343.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This kit is optimized to detect anti-rat MOG (1-125) IgG. Wells are pre-coated with recombinant rat MOG (1-125) protein and pre-blocked with BSA. The amount of anti-rat MOG IgG in serum or cerebrospinal fluid is quantified using ELISA. Ample materials and reagents are provided to perform 96 assays.

Supplier: Anaspec Inc

This peptide is amino acids 154 to 186 fragment of secretogranin II, designated secretoneurin. Secretoneurin is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II. Secretoneurin acts as direct angiogenic cytokine, inhibits endothelial cell (EC) apoptosis, stimulates EC proliferation, and activates the mitogen-activated protein kinase (MAPK) system and the Akt pathway.
Sequence:TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
MW:3652 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This sequence acts as a tethered peptide ligand. Free SFLLRN activates PAR1 independent of receptor cleavage and has been used to probe PAR1 function in various cells and tissues. This peptide is also known to be capable of activating PAR2.
Sequence:SFLLRN
MW:748.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (275-305) is a 31-amino acid long peptide derived from the Repeat 2 domain.
Sequence:VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS
MW:3263.77 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is fragment of the myelin basic protein (MBP), which corresponds to amino acids 84-96 of the murine sequence (86-98 in guinea pig; 87-99 in human).
Sequence:VHFFKNIVTPRTP
MW:1555.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Peptidyl-prolyl isomerase (PPIase) Pin1 catalyzes cis/trans isomerization of the phospho-Serine/Threonine-Proline peptide bonds

Supplier: Anaspec Inc

Renin acts on this sequence serving as its substrate yielding Angiotensin I and VIHN. It has implications in cardiovascular system.
Sequence:DRVYIHPFHLVIHN
MW:1760 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

Excitation-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration

Supplier: Anaspec Inc

This peptide is amino acids 48 to 57 fragment of TAT with an additional cysteine residue at the N-terminus. This peptide contains the protein transduction domain (PTD) of the HIV Tat protein that inhibits HSV-1 entry. The addition of a cysteine residue to the N-terminus of the Tat-PTD (Tat-C peptide) improves the antiviral activity against HSV-1 and HSV-2. Tat-C acts extracellularly, blocking entry of adsorbed virus immediately without eluting virions.
Sequence: CGRKKRRQRRR
MW: 1499.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.
Sequence: YGRKKRRQRRRAKEGANVAG
MW: 2357.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is a fusion of A208, derived from murine laminin a1, and the active site of fibronectin (GRGDS), with a glycine spacer. This peptide forms amyloid-like fibrils and promotes formation of actin stress fibers that mediate fibroblast cell attachment, offering it potential as a bioadhesive for tissue regeneration and engineering. FN-A208 interacts with IKVAV receptors and integrins. Its activity is disrupted by the presence of EDTA.
Sequence:GRGDSGAASIKVAVSADR
MW:1716.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is of Histone H4 (1-23) biotinylated through a GGK linker on the C-terminus. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLGKGGAKRHRKVLR-GGK(Biotin)-NH2
MW:2828.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This human Angiotensin I (Ang I) sequence also corresponds to horse, sheep, pig, and rat Ang I. Ang I is cleaved to Ang II by the angiotensin-converting enzyme (ACE). There is also evidence for non-angiotensin-converting enzyme-dependent conversion of Ang I to Ang II. Human chymase efficiently converts the 10-mer Ang I to the 8-mer hormone Ang II by splitting the Phe8-His9 bond in Ang I.
Sequence: DRVYIHPFHL
MW: 1296.5 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

Magainin 2 assumes an amphiphilic helix when bound to acidic phospholipids, forming a pore composed of a dynamic, peptide-lipid supramolecular complex.
Sequence:GIGKFLHSAKKFGKAFVGEIMNS
MW:2466.9 Da
% peak area by HPLC:95
Storage condition:-20° C