Order Entry
Puerto Rico
ContactUsLinkComponent
4987 results for "Anaspec Inc"

4987 Results for: "Anaspec Inc"

Sort By

SensoLyte® 520 Mouse Renin Assay Kit (Fluorimetric), AnaSpec

Supplier: Anaspec Inc

Renin, a highly specific aspartyl protease, cleaves angiotensinogen, to yield angiotensin I

Expand 1 Items
Loading...

6-TAMRA special formulation

Supplier: Anaspec Inc

6-TAMRA is the other purified single isomer of 5(6)-TAMRA. It is predominantly used for nucleotide labeling.

Expand 2 Items
Loading...

6-Carboxyfluorescein

Supplier: Anaspec Inc

6-FAM is another isomer of carboxyfluorescein. It is mainly used in sequencing of nucleic acids and labeling nucleotides.

Expand 2 Items
Loading...

HIV TAT-NSF700 Fusion Peptide

Supplier: Anaspec Inc

This peptide is the N-Ethyl-maleimide-sensitive factor (NSF) inhibitor fusion polypeptide composed of 11-amino acid cell permeable HIV transactivating regulatory protein (TAT) domain fused to a 22 amino acid NSF domain. TAT-NSF700 inhibits thrombin-induced exocytosis of endothelial cells in a dose-responsive manner.
Sequence: YGRKKRRQRRR-GGG-LLDYVPIGPRFSNLVLQALLVL
MW: 4167 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 1 Items
Loading...

Human Humanin

Supplier: Anaspec Inc

A peptide that suppresses neuronal cell death induced by the three different types (mutant amyloid precursor protein, presenilin 1, and presenilin 2) of familial Alzheimer’s Disease genes and by Aß.
Sequence:MAPRGFSCLLLLTSEIDLPVKRRA
MW:2687.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Dihydroethidium

Supplier: Anaspec Inc

Bind to DNA/RNA (red fluorescence) upon oxidation. Store at -20C desiccated and protected from light

Expand 1 Items
Loading...

SensoLyte® 440 West Nile Virus Protease Assay Kit (Fluorimetric), AnaSpec Inc.

Supplier: Anaspec Inc

West Nile virus (WNV) causes severe neurological disease and fatalities in both human and animal hosts

Expand 1 Items
Loading...

Staphylococcus aureus Recombinant Protein A (from E. coli), HiLyte Fluor® 488

Supplier: Anaspec Inc

Protein A-HiLyte™ Fluor 488 Conjugate can be used as a universal reagent to detect primary antibodies in IHC from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (green) Excitation/Emission wavelength: 499 nm/523 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development

Expand 1 Items
Loading...

Apelin 12

Supplier: Anaspec Inc

Apelin-12, one of the most potent apelin peptides, lowers blood pressure via a nitric oxide-dependent mechanism. It is also involved in the central control of feeding by stimulating cholecystokinin (CCK) secretion.
Sequence:RPRLSHKGPMPF
MW:1422.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

SensoLyte® MG Phosphate Assay Kit (Colorimetric), AnaSpec

Supplier: Anaspec Inc

The MG (Malachite Green) Phosphate Assay Kit is based on quantification of the green complex formed between Malachite Green, molybdate, and free orthophosphate

Expand 1 Items
Loading...

5-FITC cadaverine

Supplier: Anaspec Inc

Fluorescein cadaverine is a popular fluorescent transglutaminase substrate to label proteins by transaminidation. It has also been used to prepare other small fluorescent biomolecules via amidation or reductive amination.

Expand 1 Items
Loading...

Human;Pig;Rat Viasoactive intestinal peptide, FAM (Carboxyfluorescein)

Supplier: Anaspec Inc

This is a fluorescent (FAM)-labeled VIP, Abs/Em=492/518 nm, a 28-amino acid neuropeptide which is a neurotransmitter and a neuromodulator.
Sequence:FAM-HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
MW:3684.2 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

Human [Pyr11]-beta-Amyloid (11-40)

Supplier: Anaspec Inc

A hallmark of Alzheimer's disease (AD) is the presence of beta-Amyloid in plaques in the brains of patients. N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-40) and Aß (11- 40) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: Pyr-VHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3133.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...

Mouse BNP-45, AnaSpec

Supplier: Anaspec Inc

BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQGSTLRVQQRPQNSKVTHISSCFGHKIDRIGSVSRLGCNALKLL (Disulfide bridge:23 - 39)
MW:4919.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

Staphylococcus aureus Recombinant Protein A (from E. coli), HiLyte Fluor® 750

Supplier: Anaspec Inc

Protein A-HiLyte™ Fluor 750 Conjugate can be used as a universal reagent to detect primary antibodies in Western Immunoblot from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (near-infrared) Excitation/Emission wavelength: 754 nm/778 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development

Expand 1 Items
Loading...

HiLyte™ Fluor 594 acid fluorescent dye

Supplier: Anaspec Inc

HiLyte™ Fluor 594, an alternative to Alexa Fluor™ 594 and DyLight Fluor™ 594, has spectral characteristics similar to those of Texas Red.

Expand 1 Items
Loading...

S. pneumoniae Competence Stimulating Peptide-1

Supplier: Anaspec Inc

Competence stimulating peptide-1 is a 17 amino acids pheromone that is secreted by Streptococcus pneumoniae. CSP pheromone is used in-vivo for intercellular communication. This peptide activates signal transduction pathway ComABCDE, which regulates natural genetic transformation. The pheromone is ribosomally synthesized as precursor peptide. The mature pheromone is strain specific. CSP pheromone is produced by S. pneumoniae strain Rx, which is closely related to strain R6.
Sequence:EMRLSKFFRDFILQRKK
MW:2242.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Fibrinolysis Inhibiting Factor

Supplier: Anaspec Inc

This peptide mimics the N terminus of the alpha-chain of fibrin. It binds to the 'a' polymerization pocket in the alpha-chain more tightly than a peptide corresponding to the chain native sequence GPRV. The complex between GPRP and fibrinogen causes an increased resistance to degradation by plasmin, and the polymerization reaction is depressed by the addition of excess peptide. Fibrin assembly, as well as the acceleration of the factor XIIIa reaction, can be prevented by this homologue of the natural sequence of amino acids.
Sequence:GPRP
MW:425.5 Da
%Peak area by HPLC:≥95%
Storage condition:

Expand 1 Items
Loading...

GAD65 (206-220)

Supplier: Anaspec Inc

A Glutamic acid decarboxylase 2 (GAD2) peptide corresponding to residues 206 to 220 of GAD65. GAD2 is presented to T cells in association with I-Ag7 MHC class II molecules. This peptide was also used as a part of Ig chimeras to test whether IL-10 interferes with expression of CTLA-4.
Sequence:TYEIAPVFVLLEYVT
MW:1757.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human PLP

Supplier: Anaspec Inc

This is amino acids 178 to 191 fragment of the proteolipid protein (PLP), an immunodominant encephalitogenic epitope in SJL mice, one of two major encephalitogenic epitopes. PLP peptide 178 to 191 was compared with another encephalitogenic peptide, 139 to 151. The day of onset of disease induced by PLP 178 to 191 was earlier, but the incidence, severity, and histologic features were indistinguishable.
Sequence: NTWTTCQSIAFPSK
MW: 1583.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 1 Items
Loading...

[Lys(Me2)9]-Histone H3 (1-21)-K,Biotin

Supplier: Anaspec Inc

This is a biotin labeled histone 3 (H3) fragment with amino acid residues 1 to 21. Lysine 9 is di-methylated.
Sequence:ARTKQTAR-K(Me2)-STGGKAPRKQLA-K(Biotin)
MW:2637.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

AnaTag™ HiLyte™ Fluor 750 Protein Labeling Kit *Ultra Convenient*, Anaspec

Supplier: Anaspec Inc

HiLyte™ Fluor 750 acid, SE is the longest-wavelength amine-reactive HiLyte™ Fluor dye currently available. Its fluorescence emission maximum at 778 nm is well separated from commonly used far-red fluorophores such as HiLyte™ Fluor 647, HiLyte™ Fluor 680 or allophycocyanin (APC), facilitating multicolor analysis.

Expand 1 Items
Loading...

Human Glucagon-like Peptide-2, GLP-2 (146-178)

Supplier: Anaspec Inc

This is a fragment of human intestinal growth factor glucagon-like peptide 2, GLP2, containing amino acids 146 to 178. It is an intestinotrophic growth hormone that promotes many aspects of intestinal function, including enhancement of mucosal growth and promotion of nutrient absorption. GLP-2 is a hormone that can rapidly improve intestinal epithelial barrier function.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD
MW: 3766.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
Loading...

HIV Tat-NR2Bct Peptide

Supplier: Anaspec Inc

This is the membrane-permeable postsynaptic density (PSD)-95-binding (decoy) peptide Tat-NR2Bct. It can transduce into neurons in cell culture.
Sequence: YGRKKRRQRRRKLSSIESDV
MW: 2518.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 1 Items
Loading...

Human ACTH (1-39),Biotin

Supplier: Anaspec Inc

This C-terminally labeled biotin ACTH (1-39) has been used in ELISA assays. This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress. It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R).
Sequence: Biotin - SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
MW: 4768.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...

Human Peptide YY

Supplier: Anaspec Inc

PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.
Sequence:YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
MW:4309.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 2 Items
Loading...

Melan-A/MART-1 (27-35)

Supplier: Anaspec Inc

Melan-A is a melanocyte differentiation antigen recognized by cytotoxic T lymphocytes. This sequence is a naturally presented Melan-A/MART-1 nonamer peptide. The Melan-A/MART-1 gene is expressed by normal melanocytes, as well as by most fresh melanoma samples and melanoma cell lines. This peptide appears to be a very common immunogenic epitope for HLA-A2-restricted melanoma-specific tumor-infiltrating lymphocytes (TIL) and may be useful for the development of immunotherapeutic strategies.
Sequence:AAGIGILTV
MW:814.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Biotin-X NTA

Supplier: Anaspec Inc

Excellent reagent for detecting polyhistidine-containing biomolecules

Expand 1 Items
Loading...

Human Brain Natriuretic Peptide 32

Supplier: Anaspec Inc

This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
MW:3464.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 2 Items
Loading...

Substance P, FAM (Carboxyfluorescein)

Supplier: Anaspec Inc

Substance P (SP) is an important neuropeptide belonging to the tachykinin family. It acts as a neurotransmitter and neuromodulator. It is closely related to neurokinin A, both originating from the same precursor preprotachykinin A. It is released from the terminals of sensory nerves and is involved in inflammation and pain processes. This peptide is a fluorescent (FAM)-labeled Substance P, Abs/Em = 494/521 nm.
Sequence:FAM-RPKPQQFFGLM-NH2
MW:1706 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...
Sort By