Order Entry
Puerto Rico
ContactUsLinkComponent
4987 results for "Anaspec Inc"

4987 Results for: "Anaspec Inc"

Sort By

Human;Sheep;Rat PACAP (1-27), amide

Supplier: Anaspec Inc

PACAP-27, the N-terminal fragment of PACAP-38, is a neuropeptide originally isolated from bovine hypothalamus, but is also found in humans and rats. It shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), but stimulates adenylate cyclase much more potently than VIP. PACAP27 and PACAP38 stimulate cAMP accumulation and increase [Ca2+]i through the type I PACAP receptors.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
MW: 3147.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
Loading...

Mouse;Rat Beta-Amyloid (1-38)

Supplier: Anaspec Inc

This is amino acids 1 to 38 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4035.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...

[Ala13]-Apelin-13

Supplier: Anaspec Inc

[Ala13]-Apelin-13 is an Apelin-13 antagonist evidenced from its blood pressure lowering reversal effects in hypertensive rats.
Sequence:QRPRLSHKGPMPA
MW:1474.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

SensoLyte® 570 West Nile Virus Protease Assay Kit (Fluorimetric), AnaSpec

Supplier: Anaspec Inc

West Nile virus (WNV) causes severe neurological disease and fatalities in both human and animal hosts

Expand 1 Items
Loading...

Noxa BH3, Peptide 1

Supplier: Anaspec Inc

This peptide belongs to the Bcl-2 family of proteins. Noxa gene encodes a Bcl-2 homology 3 (BH3)-only member of this family; it contains the BH3 region, not other BH domains. When ectopically expressed, Noxa undergoes BH3 motif-dependent localization to mitochondria, it interacts with anti-apoptotic Bcl-2 family members resulting in the activation of caspase-9.
Sequence:PAELEVECATQLRRFGDKLNFRQKLL
MW:3075.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Pig Protegrine-1 (PG-1)

Supplier: Anaspec Inc

This peptide is Protegrin-1 (PG-1) with a modified C-terminal amide. PG-1 is an 18-amino-acid beta-hairpin antimicrobial peptide found in porcine leukocytes and belongs to the cathelicidin family. PG-1 exhibits broad-spectrum activity unaffected by extracellular NaCl concentrations and is capable of inactivating numerous bacterial strains, Candida albicans, and some enveloped viruses. The efficacy is strongly dependent upon the existence of two disulfide bonds that stabilize the beta-sheet structure.

Expand 1 Items
Loading...

HIV TAT (47-57) Biotin Peptide, Biotin

Supplier: Anaspec Inc

This is a biotinylated HIV-derived cell penetrating TAT peptide . This positively charged biotin-peptide has been used in studies to form a colloidal coat over oligonucleotides-saturated nanoparticles such that TAT-coated nanoparticles when loaded with dense SiRNA molecules could efficiently penetrate a wide variety of human embryonic stem cells.
Sequence: Biotin-YGRKKRRQRRR
MW: 1786.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 1 Items
Loading...

Influenza CEF Influenza

Supplier: Anaspec Inc

HLA-A*01 restricted epitope from influenza virus nucleoprotein (44-52).
Sequence: CTELKLSDY
MW: 1071.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 1 Items
Loading...

SensoLyte® 520 ADAMTS13 Activity Assay (Fluorimetric), AnaSpec

Supplier: Anaspec Inc

ADAMTS13 (A Disintegrin-like and Metalloprotease with Thrombospondin type-1 motifs 13) is a metalloproteinase that is primarily synthesized in liver cells and secreted into blood circulation

Expand 1 Items
Loading...

MBP MAPK Substrate

Supplier: Anaspec Inc

The sequence APRTPGGRR contains a native sequence derived from bovine myelin basic protein amino acids 95-98 (PRTP). The rest of the sequence is not derived from a native sequence, but is a synthetic construct. This substrate is specific for MAP kinases: p44MAPK [extracellular signal-regulated kinase 1 (ERK1)] and p42MAPK (ERK2). It contains the consensus sequence Pro-X-(Ser/Thr)-Pro that is recognized by MAP kinase. This peptide is the most efficient substrate for phosphorylation reaction by ERK. The substrate is phosphorylated by kinases on threonine 97 and can also be phosphorylated by MAPK p38.
Sequence:APRTPGGRR
MW:967.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Apidaecin IB

Supplier: Anaspec Inc

Apidaecin IB is an insect antimicrobial peptide showing a significant sequence homology and a common mechanism of action with drosocin, but is devoid of any pore-forming activity. Apidaecins are the most prominent components of the honey bee humoral defense against microbial invasion.
Sequence:GNNRPVYIPQPRPPHPRL
MW:2108.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

HiLyte™ Fluor 647 amine fluorescent dye

Supplier: Anaspec Inc

HiLyte™ Fluor 647 amine is a carbonyl-reactive fluorescent labeling dye that generates the conjugates that are slightly red-shifted compared to those of Cy5 dyes, resulting in an optimal match to filters designed for Cy5 dye.

Expand 1 Items
Loading...

Human Ang II TAMRA peptide, TAMRA (5-Carboxytetramethylrhodamin)

Supplier: Anaspec Inc

This is a fluorescent (TAMRA)-labeled Angiotensin II, Abs/Em = 541/565 nm.
Sequence: TAMRA-DRVYIHPF
MW: 1458.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 1 Items
Loading...

Bovine Beta-Casein, Monophosphopeptide

Supplier: Anaspec Inc

Bovine ß-Casein, monophosphopeptide (phospho-Serine) can be used for characterization of affinity purified phosphorylated peptides in liquid chromatography and for the analysis or detection of phosphorylated peptides in mass spectrometry.
Sequence:FQ-pS-EEQQQTEDELQDK
MW:2062 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Chicken OVA (257-264), FAM (Carboxyfluorescein)

Supplier: Anaspec Inc

This is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin presented by the class I MHC molecule, H-2Kb. It is fluorescent (5-FAM)-labeled, Abs/Em=494/521 nm.
Sequence: 5-FAM-SIINFEKL-NH2
MW: 1320.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...

Plasmin Substrate, AFC (Antibody-fluorophore conjugate)

Supplier: Anaspec Inc

This is a fluorescent plasmin substrate, Abs/Em=380/500 nm.
Sequence:vLK-AFC
MW:569.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

Human GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34)

Supplier: Anaspec Inc

Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
MW: 3922.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
Loading...

SensoLyte® 490 MMP-8 Assay Kit (Fluorimetric), AnaSpec

Supplier: Anaspec Inc

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Expand 1 Items
Loading...

Human;Bovine Apelin-16

Supplier: Anaspec Inc

It is one of the active peptide fragments resulting from maturation of preproapelin. Apelin family of peptides and receptor has been potentially indicated as target therapeutics of eating disorder and obesity.
Sequence:FRRQRPRLSHKGPMPF
MW:2010.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

Rabies virus Rabies Virus Glycoprotein

Supplier: Anaspec Inc

This peptide is a 29 amino acid fragment derived from rabies virus glycoprotein (RVG). Because neurotropic viruses cross the blood-brain barrier to infect brain cells, the same strategy may be used to enter the central nervous system and deliver siRNA to the brain. This peptide specifically binds to the acetylcholine receptor expressed by neuronal cells.
Sequence:YTIWMPENPRPGTPCDIFTNSRGKRASNG
MW:3266.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Amylin

Supplier: Anaspec Inc

This core region of human amylin, corresponding to amino acid residues 20 to 29, forms amyloid-like fibrils that display polymorphic structures.
Sequence: SNNFGAILSS
MW: 1009.1 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...

Crosstide

Supplier: Anaspec Inc

Crosstide is a peptide analog of glycogen synthase kinase-3 (GSK-3) that functions as a natural substrate for Akt/PKB. It displays similar specificities towards PKBα, PKBβ and PKBγ isoforms. It is also recognized by MAPKAP kinase-1 and p70S6K. The fluorescent and biotinlyated peptides demonstrate similar enzyme activities.
Sequence:GRPRTSSFAEG
MW:1164.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Dog C-peptide

Supplier: Anaspec Inc

Insulin secretory rate can be estimated from peripheral C-peptide concentrations in dogs. Plasma C-peptide concentrations during glucagon stimulation testing is variable in diabetic dogs and may represent dogs with type-1 and type-2 diabetes or more likely, differences in severity of beta-cell loss in dogs with type-1 diabetes.
Sequence: EVEDLQVRDVELAGAPGEGGLQPLALEGALQ
MW: 3174.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
Loading...

[Leu27]-Melan-A/MART-1 (26-35)

Supplier: Anaspec Inc

This Melan-A (26-35) analog, Leu substituted for Ala at position 27, shows better HLA-A*0201 binding properties as well as better immunogenicity and antigenicity than the natural Melan-A (26-35), cat # AS-61011.
Sequence:ELAGIGILTV
MW:985.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human ACTH (1-17)

Supplier: Anaspec Inc

ACTH (1–17), and aMSH (a-Melanotropin), both derived from POMC (proopiomelanocortin) are involved in melanogenesis. However, ACTH (1-17) has been found to be more potent in malanogenesis in human malanocytes. Both ACTH (1-17) and aMSH also increase dendricity, and proliferation in follicular melanocytes.
Sequence: SYSMEHFRWGKPVGKKR
MW: 2093.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...

Human hBD-1

Supplier: Anaspec Inc

Defensins are small cysteine-rich cationic proteins found in both vertebrates and invertebrates. They have host defense properties, and are active against bacteria, fungi and many viruses. Beta-defensins are the most widely distributed, being secreted by leukocytes and epithelial cells of many kinds
Sequence:DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
(Disulfide bridge: 5-34, 12-27, 17-35)
MW:3929.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Recombinant beta-Synuclein (from E. coli)

Supplier: Anaspec Inc

The sequence (Accession # NP_003076)) corresponds to the human β-synuclein along with a 6x His tag expressed in E. coli. This human β-synuclein recombinant protein is offered at a low endotoxin level of <0.1 EU per μg protein.
Beta-synuclein belongs to the family of highly conservative proteins in vertebrates. N-terminal of β-synuclein is highly homologous to α-, γ-synucleins and consists of degenerative “KTKEGV” repeats. Similar to α-synuclein, beta-synuclein is found primarily in the brain; however, it does not associate with Lewy bodies in Parkinson disease like α-synuclein. Beta-synuclein was found to inhibit production of phosphatidic acid by the phospholipase D2 transmembrane protein in vitro. In addition, beta-synuclein was detected in many breast and ovarian tumors. Recent investigations demonstrated that beta-synuclein can induce mild experimental autoimmune encephalomyelitis (EAE) in Lewis rats.
The human β-synuclein recombinant proteins from AnaSpec are offered with low endotoxin levels of <1 EU per μg protein.

Expand 2 Items
Loading...

Human Recombinant DJ-4 (from E. coli) GST Tag

Supplier: Anaspec Inc

The sequence (Accession # NP_001116849) corresponding to the full length human DJ-1 protein along with N-terminal GST tag was expressed in E. coli. The recombinant DJ-1 protein was purified from bacterial lysate using GST affinity chromatography. GST tag was not removed. The molecular weight of the recombinant GST-DJ-1protein is 47.3 kDa.
DJ-1 is also known as PARK7 (Parkinson disease protein 7). It is a 189-amino acid protein that is ubiquitously expressed in many organs including brain, liver, kidney, pancreas, heart, and others. Although DJ-1 was originally discovered as a novel oncogene product, it was found to play several other roles in biological processes. This includes the regulation of RNA binding activity, fertility, anti-oxidative stress, and is linked to the early onset of Parkinson disease when mutated. Sequence (Accession# NP_001116849) corresponds to the full length human DJ-1 protein and was expressed in E. coli.

Expand 1 Items
Loading...

Human Recombinant DJ-3 (from E. coli)

Supplier: Anaspec Inc

The sequence (Accession # NP_001116849) corresponding to the full length human DJ-1 protein along with N-terminal GST tag was expressed in E. coli. The recombinant DJ-1 protein was purified from bacterial lysate using GST affinity chromatography followed by GST tag cleavage and removal. The molecular weight of the recombinant DJ-1 protein is 19.9 kDa.
DJ-1 is also known as PARK7 (Parkinson disease protein 7). It is a 189-amino acid protein that is ubiquitously expressed in many organs including brain, liver, kidney, pancreas, heart, and others. Although DJ-1 was originally discovered as a novel oncogene product, it was found to play several other roles in biological processes. This includes the regulation of RNA binding activity, fertility, anti-oxidative stress, and is linked to the early onset of Parkinson disease when mutated. Sequence (Accession# NP_001116849) corresponds to the full length human DJ-1 protein and was expressed in E. coli.

Expand 1 Items
Loading...

S6 Kinase Substrate (229-239)

Supplier: Anaspec Inc

This is a synthetic peptide substrate for S6 kinase shown to be phosphorylated by protein kinase c with phosphorylation site identified at Ser235.
Sequence:AKRRRLSSLRA
MW:1313.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 2 Items
Loading...
Sort By