4987 Results for: "Anaspec Inc"
6-HEX, SE
Supplier: Anaspec Inc
6-HEX, SE is a popular amino-reactive fluorescent probe that is widely used in nucleic acid sequencing and related research.
Expand 1 Items
Human Beta-Amyloid (1-37)
Supplier: Anaspec Inc
Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Molecular Weight: 4074.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Expand 2 Items
SensoLyte® 520 Calpain Activity Assay Kit (Fluorimetric), AnaSpec
Supplier: Anaspec Inc
The calpains are a family of intracellular Ca2+ dependent cysteine proteases
Expand 1 Items
[Lys(Ac)5/8/12/16]-Histone H4 (1-25)-GSGSK
Supplier: Anaspec Inc
This peptide is Histone H4 amino acid residues 1-25. It is acetylated at lysine 5/8/12/16.
Sequence:SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGSK
MW:2373.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Cathepsin D and E FRET Substrate
Supplier: Anaspec Inc
Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin D is the lysosomal aspartic proteinase, active in intracellular protein breakdown. Cathepsin D is involved in the pathogenesis of several diseases such as breast cancer and Alzheimer disease. Cathepsin E is a non-lysosomal aspartic proteinase of the pepsin superfamily. It plays an important role in the protein degradation, the generation of bioactive proteins, and antigen processing. Recent studies have particularly suggested that Cathepsin E is important in host defense against cancer cells and invading microorganisms.
An internally quenched fluorogenic substrate (Ab/Em =328/393 nm) for cathepsins D and E and not for B, H or L, obtained from the hepatopancreas (liver) of the Japanese common squid (Todarodes pacificus). The cleavage occurs at the Phe-Phe amide bond resulting in enhanced fluorescence and is used in screening cathepsin D and E inhibitors and for determining cathepsin D and E activity in tissue cell extracts.
Sequence:Mca-GKPILFFRLK(Dnp)-r-NH2
MW:1756.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human Glucagon-Like Peptide 1, GLP-1 (7-37)
Supplier: Anaspec Inc
GLP-1 (7-37) is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of proglucagon. Both GLP-1 (7-36) and GLP-1 (7-37) play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. Although GLP-1 (7-37) is bioactive, it is available in lesser amounts than GLP-1 (7-36) and is not amidated.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
MW: 3355.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 2 Items
Human LL-37 fragment (18-37)
Supplier: Anaspec Inc
This is fragment 18-37 of LL-37, it exhibits enhanced antimicrobial activity. Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense (innate immunity) against local infection and systemic invasion of pathogens at sites of inflammation and wounds.
Sequence: KRIVQRIKDFLRNLVPRTES
MW: 2468.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Expand 1 Items
Rat alpha-Calcitonin Gene Related Peptide
Supplier: Anaspec Inc
α-CGRP is preferentially expressed in sensory neuron. Both alpha-CGRP and beta-CGRP increase the rate and force of atrial contractions.
Sequence:SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (Disulfide bridge: 2-7)
MW:3806.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Expand 1 Items
Human Lactoferricin H
Supplier: Anaspec Inc
This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.
Sequence:TKCFQWQRNMRKVR-G-PPVSCIKRDS (Disulfide between Cys3 and Cys20)
MW:3019.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human Calcitonin Gene Related Peptide
Supplier: Anaspec Inc
CGRP is a 37-amino acid neuropeptide produced by tissue specific processing of the calcitonin gene and is the major product in neural tissues.
Sequence:ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge: 2-7)
MW:3789.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Expand 2 Items
C3a (70-77)
Supplier: Anaspec Inc
This octapeptide is a COOH-terminal fragment of the C3a anaphylatoxin peptide. On a molar basis, this peptide possesses 1-2% of the biological activities of C3a. It causes contraction of rodent ileum and uterus, release of vasoactive amines from rat mast cells, and increases vascular permeability in guinea pig and human skin. Both purified C3a and synthetic C3a (70-77), which retains partially the activity of anaphylatoxin, are shown to interact directly with human lymphocytes.
Sequence:ASHLGLAR
MW:823.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Pep-1-Cysteamine
Supplier: Anaspec Inc
Pep-1 is one of the synthetic cell-penetrating peptides (CPPs), which has been successfully used to deliver a variety of proteins and other biopharmaceutical macromolecules into cells in a non-disruptive way. It is a CPP with primary amphipathicity (i.e amphipathicity resulting from the amino acid sequence itself, not from the folding structure) that comprises a tryptophan-rich so-called ‘hydrophobic’ domain, a hydrophilic domain derived from an NLS (nuclear localization signal) of SV40 (simian virus 40) large T-antigen, and a spacer between them. A cysteamine group is present at the C-terminus. The presence of cysteamine group in C terminal seems to play a crucial role in the delivery efficiency of cargoes into cells.
Sequence:Ac-KETWWETWWTEWSQPKKKRKV-cysteamine
MW:2950.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
AggreSure™ Human Beta-Amyloid (1-40)
Supplier: Anaspec Inc
AnaSpec's AggreSure™ beta-Amyloid (1-40) peptide is pretreated and tested for aggregation using AnaSpec's SensoLyte® ThT Aβ40 Aggregation kit (Cat# AS-72213).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Expand 1 Items
Human;Mouse;Rat Biotin-LC-Beta-Amyloid (15-25), Biotin
Supplier: Anaspec Inc
This is a biotinylated fragment of the human, mouse, rat ß-amyloid (15-25).
Sequence: Biotin-LC-QKLVFFAEDVG
Molecular Weight: 1591.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Expand 1 Items
Bovine Rhodopsin Epitope Tag
Supplier: Anaspec Inc
This is a 9-amino acid peptide corresponding to the C-terminus of bovine rhodopsin. It is widely used as an epitope tag. A number of anti-rhodopsin antibodies recognize this epitope.
Sequence:TETSQVAPA
MW:903 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Bim BH3, Peptide IV
Supplier: Anaspec Inc
This Bim peptide belongs to the pro-apoptotic group of the Bcl-2 family of proteins.
Sequence:DMRPEIWIAQELRRIGDEFNAYYARR
MW:3269.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
SensoLyte® 520 Neprilysin Activity Assay Kit (Fluorimetric), AnaSpec
Supplier: Anaspec Inc
Neprilysin (NEP) is a transmembrane metallopeptidase normally expressed by a variety of tissues
Expand 1 Items
Histone H3 (23-34)
Supplier: Anaspec Inc
This peptide is Histone H3 amino acid residues 23 to 34.
Sequence:KAARKSAPATGG
MW:1114.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human [Met]-beta-Amyloid (1-42), TAMRA (5-Carboxytetramethylrhodamin)
Supplier: Anaspec Inc
This is b-amyloid (1-42) peptide with an N-terminal methionine is labeled with a fluorescent dye, 5-TAMRA (Ex/Em= 544/572 nm), on the N-terminus.
Sequence: 5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 5057.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Expand 1 Items
GRGDS, Amide
Supplier: Anaspec Inc
This peptide inhibits the adhesion of human ovarian carcinoma OVCAR-3 cells to fibronectin, but not to laminin.
Sequence:GRGDS-NH2
MW:489.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human LL-37 Peptide
Supplier: Anaspec Inc
Antimicrobial peptide LL-37, belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution.
Sequence: [LL-37, 37 aa]
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Expand 1 Items
Human Insulin B (9-23)
Supplier: Anaspec Inc
This insulin B-chain peptide binds to a class II histocompatibility complex (MHC) allele called I-Ag7. A number of autoimmune diseases has been linked to class II proteins encoded by the MHC. Type 1 diabetes, or insulin-dependent diabetes mellitus, is a T cell-mediated disease that results in autoimmune destruction of pancreatic beta-cells leading to hyperglycemia. This insulin B peptide may be a self-antigen candidate that could initiate the disease. Immunization with this peptide in mice led to autoantibodies and insulitis.
Sequence: SHLVEALYLVCGERG
MW: 1645.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 1 Items
S. pneumoniae CFP10 (71–85)
Supplier: Anaspec Inc
This 15-mer peptide is fragment of (CFP)10 protein, which is secreted from mycobacterium tuberculosis 10-kDa culture filtrate stimulate IFN-gamma; production and CTL activity by CD4+ and CD8+ cells, from persons expressing a spectrum of MHC molecules. This peptide is an excellent candidate for inclusion in a subunit antituberculosis vaccine.
Sequence:EISTNIRQAGVQYSR
MW:1721.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Hen Elafin
Supplier: Anaspec Inc
This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens.
Sequence:AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
MW:5999.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Rat Uroguanylin
Supplier: Anaspec Inc
Uroguanylin is a natriuretic peptide, a hormone that regulates sodium excretion by the kidney when excess NaCl is consumed. Uroguanylin and guanylin are related peptides that activate common guanylate cyclase signaling molecules in the intestine and kidney. Uroguanylin was isolated from urine and duodenum but was not detected in extracts from the colon of rats.
Sequence:TDECELCINVACTGC (Disulfide bonds between Cys4-Cys12 and Cys7-Cys15)
MW:1569.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Expand 1 Items
E alpha (52–68)
Supplier: Anaspec Inc
This peptide is MHC class II antigen E alpha
Sequence:ASFEAQGALANIAVDKA
MW:1675.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human [Lys22]-beta-Amyloid (1-42)
Supplier: Anaspec Inc
This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Expand 1 Items
Human [FAM-Trp31]-GLP-1 (7-36), Fluorescent label at Trp31, FAM (Carboxyfluorescein)
Supplier: Anaspec Inc
This GLP-1 (7-36) amide peptide is fluorescently labeled at Tryptophan residue 25 with Fluorescein. This is the same type of fluorescent labeling as in Extendin-4 Flex peptide (Cat# AS-63899). GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIA (Trp-S-FAM)-LVKGR-NH2
MW: 3717.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 1 Items
Erythropoietin-Mimetic Peptide 17 (EMP17)
Supplier: Anaspec Inc
EMP17 is an erythropoietin (EPO)-mimetic peptide. Erythropoietin (EPO) is the hormone involved in red blood cell production, which activates its receptor by binding to the receptor's extracellular domain and presumably dimerizing two receptor monomers to initiate signal transduction. EMP contains two potentially reactive amines, one at the amino terminus of the peptide and one in the side chain of the single lysine within the peptide sequence.
Sequence: TYSCHFGPLTWVCKPQGG
MW: 1981.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 1 Items
Human [Arg6]-beta-Amyloid (1-42)
Supplier: Anaspec Inc
This is amino acids 1 to 42 beta-amyloid with the England mutation where His6 is replaced by Arg6. This novel familial Alzheimer’s disease (FAD) -linked APP mutation accelerates the fibril elongation rate without a concomitant increase in the levels of protofibrils. The proband in the English family was diagnosed at 55 years of age.
Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
MW: 4533.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C