Order Entry
Puerto Rico
ContactUsLinkComponent
 

4987 Results for: "Anaspec Inc"

Human LL-37 Peptide

Supplier: Anaspec Inc

Antimicrobial peptide LL-37,  belongs  to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human.  It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds.  Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution. 
Sequence: [LL-37, 37 aa]
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...

Human Insulin B (9-23)

Supplier: Anaspec Inc

This insulin B-chain peptide binds to a class II histocompatibility complex (MHC) allele called I-Ag7. A number of autoimmune diseases has been linked to class II proteins encoded by the MHC. Type 1 diabetes, or insulin-dependent diabetes mellitus, is a T cell-mediated disease that results in autoimmune destruction of pancreatic beta-cells leading to hyperglycemia. This insulin B peptide may be a self-antigen candidate that could initiate the disease. Immunization with this peptide in mice led to autoantibodies and insulitis.
Sequence: SHLVEALYLVCGERG
MW: 1645.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
Loading...

S. pneumoniae CFP10 (71–85)

Supplier: Anaspec Inc

This 15-mer peptide is fragment of (CFP)10 protein, which is secreted from mycobacterium tuberculosis 10-kDa culture filtrate stimulate IFN-gamma; production and CTL activity by CD4+ and CD8+ cells, from persons expressing a spectrum of MHC molecules. This peptide is an excellent candidate for inclusion in a subunit antituberculosis vaccine.
Sequence:EISTNIRQAGVQYSR
MW:1721.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Hen Elafin

Supplier: Anaspec Inc

This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens.
Sequence:AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
MW:5999.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Rat Uroguanylin

Supplier: Anaspec Inc

Uroguanylin is a natriuretic peptide, a hormone that regulates sodium excretion by the kidney when excess NaCl is consumed. Uroguanylin and guanylin are related peptides that activate common guanylate cyclase signaling molecules in the intestine and kidney. Uroguanylin was isolated from urine and duodenum but was not detected in extracts from the colon of rats.
Sequence:TDECELCINVACTGC (Disulfide bonds between Cys4-Cys12 and Cys7-Cys15)
MW:1569.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

E alpha (52–68)

Supplier: Anaspec Inc

This peptide is MHC class II antigen E alpha
Sequence:ASFEAQGALANIAVDKA
MW:1675.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human [Lys22]-beta-Amyloid (1-42)

Supplier: Anaspec Inc

This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...

Human [FAM-Trp31]-GLP-1 (7-36), Fluorescent label at Trp31, FAM (Carboxyfluorescein)

Supplier: Anaspec Inc

This GLP-1 (7-36) amide peptide is fluorescently labeled at Tryptophan residue 25 with Fluorescein. This is the same type of fluorescent labeling as in Extendin-4 Flex peptide (Cat# AS-63899). GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIA (Trp-S-FAM)-LVKGR-NH2
MW: 3717.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
Loading...

Erythropoietin-Mimetic Peptide 17 (EMP17)

Supplier: Anaspec Inc

EMP17 is an erythropoietin (EPO)-mimetic peptide. Erythropoietin (EPO) is the hormone involved in red blood cell production, which activates its receptor by binding to the receptor's extracellular domain and presumably dimerizing two receptor monomers to initiate signal transduction. EMP contains two potentially reactive amines, one at the amino terminus of the peptide and one in the side chain of the single lysine within the peptide sequence.
Sequence: TYSCHFGPLTWVCKPQGG
MW: 1981.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
Loading...

Human [Arg6]-beta-Amyloid (1-42)

Supplier: Anaspec Inc

This is amino acids 1 to 42 beta-amyloid with the England mutation where His6 is replaced by Arg6. This novel familial Alzheimer’s disease (FAD) -linked APP mutation accelerates the fibril elongation rate without a concomitant increase in the levels of protofibrils. The proband in the English family was diagnosed at 55 years of age.
Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
MW: 4533.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...

O-linked GlcNAc transferase (OGT) Substrate

Supplier: Anaspec Inc

A peptide substrate of O-linked GlcNAc transferase (OGT), a eukaryotic glycosyltransferase that uses UDP-GlcNAc as a glycosyl donor.
Sequence:KKKYPGGSTPVSSANMM
MW:1783.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Beta-Amyloid (1-40)-Lys(Biotin)-NH₂, Biotin, AnaSpec

Supplier: Anaspec Inc

This is amino acids 1 to 40 fragment of human beta-amyloid differing from those in rat, mouse by three amino acid residues in Arg5, Tyr10, and His13. This peptide is biotinylated at the C-terminus.

Expand 2 Items
Loading...

GRGDS, AnaSpec

Supplier: Anaspec Inc

GRGDS is the cell adhesion sequence of osteopontin that recognizes the avb3 integrin. Osteopontin is overexpressed in experimental models of malignancy.
Sequence:GRGDS
MW:490.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Plants Phytochelatin 6

Supplier: Anaspec Inc

A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 6 units of gammaGlu-Cys.
Sequence:(γE-C)6-G
MW:1468.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

PrP (106-126)

Supplier: Anaspec Inc

Prion protein (PrP), also known as CD230, is mainly produced in the nervous sytem. PrP exists as different isoforms, among which the normal PrPc, and the 'scrapie' isoform PrPSc. PrPSc is misfolded and associated to multiple disorders including bovine spongiform encephalopathy, Gerstmann-Straüssler-Scheindker disease (GSS) and the Creutzfeldt-Jakob disease. It contains a much higher beta-sheet content than PrPc, and tends to form protease-resistant aggregates. A hypothesis to support the propoagation of these aggregates and their role in neurodegeneration is that the change from normal PrPc is due to its interaction with PrPSc 'conformation conversion hypothesis).
PrP 127-147 forms filamentous structures ressembling scrapie-associated fibrils, but possesses a lower amyloidogenic potential than PrP 106-126.
Sequence:KTNMKHMAGAAAAGAVVGGLG
MW:1912.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Caerulein

Supplier: Anaspec Inc

Caerulein, a decapeptide analog of the potent pancreatic secretagogue cholecystokinin, stimulates gastric, biliary, and pancreatic secretion. Caerulein injections cause acute pancreatitis in mice.
Sequence: Pyr-QD-Y(SO3H)-TGWMDF-NH2
MW: 1352.4 Da
% Peak area by HPLC: 95
Storage condition:

Expand 1 Items
Loading...

Fluorescein biotin

Supplier: Anaspec Inc

Green fluorescent biotin used for studying avidin binding

Expand 1 Items
Loading...

Tyrosine Kinase Peptide 1

Supplier: Anaspec Inc

Peptide sequence KVEKIGEGTYGVVYK is derived from the amino acid residues CDC26-20. It is considered to be a generic substrate for various TPKs.
Sequence:KVEKIGEGTYGVVYK
MW:1669.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

AnaTag™ 5 - FITC Microscale Protein Labeling Kit *Ultra Convenient*, Anaspec

Supplier: Anaspec Inc

Fluorescein isothiocyanate (FITC) remains one of the most popular fluorescent labeling reagents, probably due to the low cost of the material. 5-FITC and 6-FITC have very similar absorption and fluorescence spectra. However, the isomers may differ in their binding and reactivity to proteins, and the conjugates may elute under different chromatographic conditions or migrate differently in electrophoretic gels.

Expand 1 Items
Loading...

SensoLyte® Generic MMP Assay Kit (Colorimetric), AnaSpec Inc.

Supplier: Anaspec Inc

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Expand 1 Items
Loading...

Human Recombinant Sirtuin (from E. coli)

Supplier: Anaspec Inc

This human recombinant SIRT2 is in its active form, and can be used for enzyme activity assays. The recombinant human Sirtuin 2 (GenBank Accession #: NM_030593) with 13-319 amino acids and His tag at its C-terminal was expressed in E. coli. The molecular mass of the enzyme is approximately 35.5 kDa on SDS-PAGE.
Sirtuins comprise a unique class of nicotinamide adenine dinucleotide (NAD+)-dependent deacetylases (class III HDACs) targeting multiple protein substrates.
Sirtuin 1 (SIRT1), the human homolog of yeast Sir2 (Silent Information Regulator 2), is the most studied of the seven members of sirtuin family. SIRT1 have been implicated in several important cellular processes, including genomic stability and DNA repair, p53-mediated apoptosis, adipogenesis, and aging.
Substrates for SIRT2 are not limited to histones but also include various transcription factors and co-regulators that modulate metabolic, cell cycle and cell death related pathways. Human SIRT2 is a cytoplasmic protein that increases in abundance during mitosis and regulates major events of cytokinesis.

Expand 1 Items
Loading...

SensoLyte® 490 MMP-9 Assay Kit (Fluorimetric), AnaSpec

Supplier: Anaspec Inc

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Expand 1 Items
Loading...

SensoLyte® ADHP Peroxidase Assay Kit (Fluorimetric), AnaSpec Inc.

Supplier: Anaspec Inc

HRP conjugates are extensively used as secondary detection reagents in ELISAs, immuno-histochemical techniques and Northern, Southern and Western blot analyses.

Expand 1 Items
Loading...

SensoLyte® FDP Alkaline Phosphatase Assay Kit Fluorimetric, AnaSpec, Inc.

Supplier: Anaspec Inc

Conjugates of calf intestinal alkaline phosphatase are extensively used as secondary detection reagents in ELISAs, immunohistochemical techniques and Northern, Southern and Western blot analyses

Expand 1 Items
Loading...

5(6)-Carboxyfluorescein

Supplier: Anaspec Inc

Although FITC reagents have been more often used to prepare fluoresceinated bioconjugates, the low stability of FITC bioconjugates makes some researchers use amine-reactive succinimidyl esters of carboxyfluorescein (commonly called FAM) in bioconjugations. FAM reagents give carboxamides that are more resistant to hydrolysis. We have shown that FAM reagents require less stringent reaction conditions and give better conjugation yields, and the resulted conjugates have superior stability. We noted that FITC labeled peptides tend to deteriorate more quickly than the corresponding FAM conjugates.

Expand 4 Items
Loading...

3,3'-Dipropylthiadicarbocyanine iodide [DiSC3(5)] ≥95% (by HPLC)

Supplier: Anaspec Inc

3,3'-Dipropylthiadicarbocyanine iodide [DiSC3(5)] ≥95% (by HPLC)

Expand 1 Items
Loading...

Fluorescein-5-thiosemicarbazide

Supplier: Anaspec Inc

5-FTSC reacts with ketones to yield relatively stable hydrazones and with aldehydes to yield hydrazones that are somewhat less stable, though they may be formed faster (compared to ketones). These hydrazones are generally reduced with sodium borohydride (NaBH4) to further increase the stability of the linkage. 5-FTSC has been used to make a wide variety of biomolecules such as L-aspartase-a-decarboxylase, enzyme-oxidized live plant protoplasts, immunoglobulins, thrombin and antithrombin.

Expand 1 Items
Loading...

DABCYL Plus™ acid, SE ≥95%

Supplier: Anaspec Inc

The absorption spectrum of DABCYL Plus™ is environment-sensitive as in the case of DABCYL dyes. For example, in water, the spectrum of DABCYL Plus™ is red-shifted ca. 40 nm compared to that in methanol.

Expand 1 Items
Loading...

Wasp Mastoparan

Supplier: Anaspec Inc

This 14-residue peptide toxin from the wasp venom is originally found as a histamine releaser from mast cells. It induces mitochondrial membrane permeabilization via a CsA-inhibitable mechanism.
Sequence:INLKALAALAKKIL-NH2
MW:1478.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 2 Items
Loading...

S6 Kinase Substrate (229-239)

Supplier: Anaspec Inc

This is a synthetic peptide substrate for S6 kinase shown to be phosphorylated by protein kinase c with phosphorylation site identified at Ser235.
Sequence:AKRRRLSSLRA
MW:1313.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 2 Items
Loading...