"Anaspec"

Supplier: Anaspec

Sulforhodamine 101 C2 maleimide is an excellent thiol-reactive reagent for protein modifications. It reacts with thiol compounds such as amino acid, peptides and proteins to give bright red fluorescent conjugates that have the identical fluorescent spectral properties of Texas Redâ-derived biopolymers, in particular, antibodies.

Supplier: Anaspec

Myelin Oligodendrocyte Glycoprotein (MOG) is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system (CNS). Although MOG protein constitutes only 0.01-0.05% of the CNS myelin proteins, it was demonstrated that MOG protein is a crucial autoantigen for multiple sclerosis in humans and experimental autoimmune encephalomyelitis (EAE) in rodents and monkeys

The sequence (Accession # CAQ10087) corresponding to the extracellular domain of human MOG along with a 6x His tag was expressed in E. coli. The recombinant human MOG (H-rMOG) was purified from urea denatured bacterial lysate using immobilized metal affinity chromatography (IMAC). The molecular mass of the recombinant human MOG is 14.2 kDa

Supplier: Anaspec

Neprilysin (NEP) is a transmembrane metallopeptidase normally expressed by a variety of tissues

Supplier: Anaspec

Spectrally similar to Cy7 dye, HiLyte™ Fluor 750 acid, SE is the longest-wavelength amine-reactive HiLyte™ Fluor dye currently available.

Supplier: Anaspec

Anionic interaction of Aß(1-11) with Factor XII is suspected to cause the massive activation of the C4 (Complement 4) system in cerebrospinal fluid of Alzheimer’s disease patients.
Sequence: DAEFRHDSGYE
Molecular Weight: 1325.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

This human recombinant SIRT2 is in its active form, and can be used for enzyme activity assays. The recombinant human Sirtuin 2 (GenBank Accession #: NM_030593) with 13-319 amino acids and His tag at its C-terminal was expressed in E. coli. The molecular mass of the enzyme is approximately 35.5 kDa on SDS-PAGE.
Sirtuins comprise a unique class of nicotinamide adenine dinucleotide (NAD+)-dependent deacetylases (class III HDACs) targeting multiple protein substrates.
Sirtuin 1 (SIRT1), the human homolog of yeast Sir2 (Silent Information Regulator 2), is the most studied of the seven members of sirtuin family. SIRT1 have been implicated in several important cellular processes, including genomic stability and DNA repair, p53-mediated apoptosis, adipogenesis, and aging.
Substrates for SIRT2 are not limited to histones but also include various transcription factors and co-regulators that modulate metabolic, cell cycle and cell death related pathways. Human SIRT2 is a cytoplasmic protein that increases in abundance during mitosis and regulates major events of cytokinesis.

Supplier: Anaspec

This C-terminal biotinylated Aß(1-40) contains a 6-carbon long chain (LC) to provide more accesibility for avidin attachment.

Supplier: Anaspec

Spectrally similar to Cy7 dye, HiLyte™ Fluor 750 C2 maleimide is the longest-wavelength thiol-reactive HiLyte™ Fluor dye currently available.

Supplier: Anaspec

This is a synthetic peptide substrate for S6 kinase shown to be phosphorylated by protein kinase c with phosphorylation site identified at Ser235.
Sequence:AKRRRLSSLRA
MW:1313.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A is a non-glycosylated cell wall protein of Staphylococcus aureus that can bind the Fc part of immunoglobulin molecule of different species with strong affinity (1-4). Protein A consists of five IgG binding domains (A, B, C, D, and E), each approximately 60 amino acids long with no cysteines present and two S. aureus cell membrane binding domains, X and M (3).
Application: Recombinant Protein A can be used for immunoprecipitation, antibodies purification, and assay development.

Supplier: Anaspec

Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. Tat-Beclin-1, scrambled will not induce autophagy and can be used as a negative control. RELATED PRODUCTS:Tat-Beclin-1, Cat# 65467Beclin-1, Cat# 65466
Sequence: YGRKKRRQRRRGGVGNDFFINHETTGFATEW
MW: 3741.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec

This GRG containing peptide is amino acids 1 to 20 fragment of histone 4. It is a substrate for human protein-arginine methyltransferase 7 (PRMT7), a type II methyltransferase capable of producing symmetrical dimethyl arginine (sDMA) modifications in proteins.
Sequence:SGRGKGGKGLGKGGAKRHRK-NH2
MW:1991.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is a 9-amino acid peptide corresponding to the C-terminus of bovine rhodopsin. It is widely used as an epitope tag. A number of anti-rhodopsin antibodies recognize this epitope.
Sequence:TETSQVAPA
MW:903 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 40-1.
Sequence: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

The sequence (Accession # AAC04279.1) corresponding to the full length human Tau-441 (2N4R isoform) protein along with GST tag at N-terminal was expressed in E. coli. The recombinant GST-Tau-441 protein was purified from bacterial lysate using proprietary method.
Microtubule associated protein (Tau) is found predominantly in the central neural system and its major function is to promote assembly and to stabilize neuronal microtubules. Six isoforms of Tau were identified in humans that are differentiated by the exclusion or inclusion of exons 2, 3, and 10. Tau-441 is the longest of Tau isoforms, consisting of 441 amino acids with molecular mass of 45.8 kDa. Under physiological conditions Tau can undergo abnormal phosphorylation, truncation, or other modifications that result in the protein detachment from microtubules. These modified Tau molecules can self-associate and form different types of aggregates including neurofibrillary tangles (NFTs) found in brains of patients with neurodegenerative diseases such as Alzheimer’s disease.

Supplier: Anaspec

A dimer of CKS-17 has a natural occurring cysteine at the carboxyl terminus (where it occurs in the retroviral peptides on which CKS-17 is based) and dimerization is accomplished by cysteine-disulfide linkage. CKS-17 is a synthetic retroviral envelope heptadecapeptide corresponding to a region highly conserved in retroviral transmembrane proteins such as pl5E. The CKS-17 peptide has been previously shown to inhibit monocyte superoxide production, natural killer cell activity, polyclonal B-cell activation, and monocyte-mediated killing by inactivation of interleukin-1.
Sequence:LQNRRGLDLLFLKEGGLC (dimer)
MW:4088.8 Da
% peak area by HPLC:95
Storage condition:-20° C