38 Results for: "454733"

Corrected to: 4433

Sort By

Undecanophenone ≥98.0%

Supplier: TCI America

CAS Number: 4433-30-1
MDL Number: MFCD00051548
Molecular Formula: C17H26O
Molecular Weight: 246.39
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Color: White
Freezing point (°C): 28

Expand 2 Items

4'-Chloro-2',5'-dimethoxyacetoacetanilide ≥98.0% (by HPLC, total nitrogen)

Supplier: TCI America

CAS Number: 4433-79-8
MDL Number: MFCD00026256
Molecular Formula: C12H14ClNO4
Molecular Weight: 271.70
Purity/Analysis Method: >98.0% (HPLC,N)
Form: Crystal
Melting point (°C): 108
Flash Point (°C): 170

Expand 1 Items

5-Hydroxymethyluracil 98%

Supplier: Thermo Scientific Chemicals

5-(Hydroxymethyl)pyrimidine-2,4-dione Uracil-5-methanol. Grade: 98, Melting Point C>300*. Boiling Point C: NA. C5H6N2O3. 4433-40-3.

Expand 2 Items

4'-Chloro-2',5'-dimethoxyacetoacetanilide 98%

Supplier: Ambeed

N-(4-Chloro-2,5-dimethoxyphenyl)-3-oxobutanamide, Purity: 98%, CAS number: 4433-79-8, Appearance: White to Light yellow powder to crystal, Storage: Sealed in dry, Room Temperature, Size: 5G

Expand 1 Items

5-Hydroxymethyluracil 95%

Supplier: Ambeed

5-(Hydroxymethyl)pyrimidine-2,4(1H,3H)-dione, Purity: 95%, CAS number: 4433-40-3, Appearance: Form: powder Colour: white to off white, Storage: Sealed in dry, Room Temperature, Size: 1G

Expand 7 Items

Ethylboronic acid ≥98%

Supplier: BeanTown Chemical

CAS: 4433-63-0; MDL No: MFCD01074536 Crystalline; Linear Formula: CH3CH2B(OH)2; MW: 73.89 Melting Point: 84-88° Air Sensitive

Expand 3 Items

Ethylboronic acid 97%

Supplier: Ambeed

Ethylboronic acid, Purity: 97%, CAS number: 4433-63-0, Appearance: Form: Crystal - Powder, Storage: Inert atmosphere, Store in freezer, under -20C, Size: 100G

Expand 3 Items

4,4-Divinyl-p-biphenyl

Supplier: Matrix Scientific

MF=C16H14 MW=206.29 Cas=4433-13-0 1G

Expand 2 Items

5-Hydroxymethyluracil ≥98%

Supplier: BeanTown Chemical

CAS: 4433-40-3; EC No: 224-636-5; MDL No: MFCD00006070; RTECS: YR0513000 Powder; Molecular Formula: C5H6N2O3; MW: 142.11 Melting Point: 300°

Expand 2 Items

Human Cys-beta-Amyloid (1-40)

Supplier: Anaspec Inc

Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4433 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items

4,4-Divinyl-p-biphenyl 95% stabilized

Supplier: Ambeed

4,4'-Divinyl-1,1'-biphenyl, Purity: 95% mix TBC as stabilizer, CAS Number: 4433-13-0, Appearance: Powder or crystals, Storage: Sealed in dry, Store in freezer, under -20 C, Size: 1g

Expand 3 Items

2,2'-Bipyridine-3,3'-dicarboxylic acid 97%

Supplier: Ambeed

[2,2'-Bipyridine]-3,3'-dicarboxylic acid, Purity: 97%, CAS Number: 4433-01-6, Appearance: Form: Crystal - Powder, Storage: Inert atmosphere, Room Temperature, Size: 5g

Expand 3 Items

Human Beta-Amyloid (1-40)

Supplier: Anaspec Inc

This synthetic peptide corresponds to ß--Amyloid (1-40) with an additional cysteine at the C-terminus.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC
Molecular Weight: 4433 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items

Ethylboronic acid 98%

Supplier: Thermo Scientific Chemicals

98% 5G

Expand 3 Items

Undecanophenone 95%

Supplier: Ambeed

Undecanophenone 95%

Expand 2 Items

Ethylboronic acid 95%

Supplier: Thermo Scientific Chemicals

Ethylboronic acid 95%

Expand 2 Items

4'-Chloro-2',5'-dimethoxyacetoacetanilide

Supplier: Matrix Scientific

4'-Chloro-2',5'-dimethoxyacetoacetanilide

Expand 1 Items

5-Hydroxymethyluracil ≥98%

Supplier: Matrix Scientific

Matrix Scientific Part Number: 021152-1G , MDL Number: MFCD00056024

Expand 2 Items

Ethylboronic acid ≥97%

Supplier: Matrix Scientific

Matrix Scientific Part Number: 007686-1G , MDL Number: MFCD01074536

Expand 3 Items

Acrodisc® Syringe Filters, DMSO-Safe, Sterile, Cytiva (Formerly Pall Lab)

Supplier: Cytiva

These 25mm filters are ideal for the sterilization of media used for cell cryopreservation.

Expand 1 Items

VWR® Universal Pipette Tips

Supplier: VWR International

VWR® Universal low retention pipette tips repel liquid by creating a hydrophobic surface on the inside of the tip increasing your accuracy and data quality.

Sustainable Options Available