54886 Results for: "(3aS,8aS)-Octahydropyrrolo[3,2-b]azepin-5-one"

Supplier: Oxford Nanopore Technologies

A sequencing kit optimised for sequencing native RNA with improved output and accuracy.

Supplier: BIOASSAY SYSTEMS

Bioluminescent dual reagent system for rapid quantitation of firelfy and Ranilla luciferase reporter gene expression in transfected cells.

Supplier: BIOASSAY SYSTEMS

For quantitative determination of succinate (succinic acid) in food, beverage, agricultural products, and other biological samples.

Supplier: Rockland Immunochemical

Human Interleukin-13 AccuSignal ELISA Kit

Supplier: NABERTHERM INC.

The muffle furnaces L 1/12 - LT 40/12 are the right choice for daily laboratory use.

Supplier: Labconco

This accessory for Protector® ClassMate® Fume Hoods is a powder-coated steel adapter

Supplier: Anaspec

This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens.
Sequence:AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
MW:5999.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This insulin B-chain peptide binds to a class II histocompatibility complex (MHC) allele called I-Ag7. A number of autoimmune diseases has been linked to class II proteins encoded by the MHC. Type 1 diabetes, or insulin-dependent diabetes mellitus, is a T cell-mediated disease that results in autoimmune destruction of pancreatic beta-cells leading to hyperglycemia. This insulin B peptide may be a self-antigen candidate that could initiate the disease. Immunization with this peptide in mice led to autoantibodies and insulitis.
Sequence: SHLVEALYLVCGERG
MW: 1645.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: BioVendor

Quality control test, Indirect ELISA – to determine titer of the antibody , SDS PAGE – to determine purity of the antibody, and BCA - to determine quantity of the antibody.

Supplier: Prosci

Polyclonal antibody GFP Host: Rabbit Species reactivity: Green Fluorescent Protein immunogen: Green Fluorescent Protein (GFP) fusion protein corresponding to the full length amino acid sequence (246aa)derived from the jellyfish Aequorea victoria. Tested application: ELISA, WB, IHC

Supplier: Thermo Fisher Scientific

Difco Yeast Extracts are concentrates of the water-soluble portion of autolyzed Saccharomyces cerevisiae cells. Our yeast extracts are derived from primary grown baker’s yeast. These animal origin-free products are suitable for use as multi-functional nutritional supplements in mammalian cell culture, microbial fermentation, and insect cell culture applications.

Supplier: Pickering Labs

Vector PCX provides the selectivity and sensitivity required for most standard post-column applications while being reliable and easy to use. Since Vector PCX does not have a column oven it is important to use the HPLC column oven to ensure stable column temperature and prevent retention time drifts and separation problems.

Supplier: AZENTA US, INC

Azenta Life Sciences tri-coded tubes offer unequaled sample audit traceability, enabling sample tracking and data sharing between multiple users, labs, locations and automation capabilities.

Supplier: AZENTA US, INC

Azenta Life Sciences tri-coded tubes offer unequaled sample audit traceability, enabling sample tracking and data sharing between multiple users, labs, locations and automation capabilities.

Supplier: Heidolph NA, LLC

Radleys reactor-ready duo lab reactor shares the same unique features as Radleys reactor-ready lab reactor, except that it supports two separate jacketed glass reaction vessels

Supplier: Biosensis

BDNF belongs to the neurotrophin family and regulates the survival and differentiation of neurons during development. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. FUNCTION: Promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. Post Translation Modification (PTM): The propeptide is N-glycosylated and glycosulfated. PTM: Converted into mature BDNF by plasmin (PLG) (By similarity). DISEASE: Defects in BDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. CCHS is frequently complicated with neurocristopathies such as Hirschsprung disease that occurs in about 16% of CCHS cases. SIMILARITY: Belongs to the NGF-beta family.

Supplier: New England Biolabs (NEB)

The EpiMark N6-Methyladenosine Enrichment Kit contains a rabbit monoclonal antibody specific for N6-Methyladenosine (m6A).

Supplier: VWR International

Erlenmeyer shaker flasks provide excellent optical clarity and mechanical strength. These flasks can be used for suspension cell culture, storage, mixing and other purposes. Baffled bottom design for improved ventilation.

Supplier: Cytiva

Sephadex G-25 is well established gel filtration medium for desalting and buffer exchange in industrial applications.

Supplier: AZENTA US, INC

Azenta Life Sciences tri-coded tubes offer unequaled sample audit traceability, enabling sample tracking and data sharing between multiple users, labs, locations and automation capabilities.

Supplier: AZENTA US, INC

Azenta Life Sciences tri-coded tubes offer unequaled sample audit traceability, enabling sample tracking and data sharing between multiple users, labs, locations and automation capabilities.

Supplier: Heidolph NA, LLC

Pump drives are ideal for all standard applications involving corrosive solvents or sterilized media

Supplier: Biotium

HSP27, Monoclonal antibody, Clone: G3.1, Host: Mouse, Species reactivity: Mouse, Chimpanzee, Monkey, Sheep, Rat, Human, Chicken, Isotype: IgG2a, kappa, BSA-free, Immunogen: Partially purified hsp27 (earlier called 24K) protein from breast cancer MCF-7 cells, Size: 50 uL

Supplier: Eagle Biosciences

HtrA1 ELISA determines HtrA1 in serum, tissue (Placenta) and cell culture supernatants.

Supplier: Biotium

Kappa Light Chain, Monoclonal antibody, Clone: Kap-56, Host: Mouse, Species reactivity: Human, Isotype: IgG1, kappa, Conjugate: CF488A, Immunogen: Purified human Ig kappa chain (HP6053) & Human B-Lymphoma Cells (L1C1), Synonyms: Ig Kappa Chain C Region, Size: 100uL

Supplier: Biotium

Kappa Light Chain, Monoclonal antibody, Clone: L1C1, Host: Mouse, Species reactivity: Human, Isotype: IgG1, kappa, Conjugate: CF488A, Immunogen: Purified human Ig kappa chain (HP6053) & Human B-Lymphoma Cells (L1C1), Synonyms: Ig Kappa Chain C Region; IGKC, Size: 500uL

Supplier: Biotium

Lambda Light Chain, Monoclonal antibody, Clone: ICO-106, Host: Mouse, Species reactivity: Human, Isotype: IgG2a, kappa, Conjugate: CF640R, Immunogen: Purified IgG myeloma proteins coupled to polyaminostyren, Synonyms: BJP, Application: IF, Size: 100uL

Supplier: Biotium

Kappa Light Chain, Monoclonal antibody, Clone: HP6053, Host: Mouse, Species reactivity: Human, Isotype: IgG1, kappa, Conjugate: CF568, Immunogen: Purified human Ig kappa chain (HP6053) & Human B-Lymphoma Cells (L1C1), Synonyms: Ig Kappa Chain C Region; IGKC, Size: 500uL

Supplier: Biotium

Lambda Light Chain, Monoclonal antibody, Clone: ICO-106, Host: Mouse, Species reactivity: Human, Isotype: IgG2a, kappa, Conjugate: CF594, Immunogen: Purified IgG myeloma proteins coupled to polyaminostyren, Synonyms: BJP, Application: IF, Size: 100uL

Supplier: Promega Corporation

TNT Coupled Reticulocyte Lysate Systems are single-tube, coupled transcription/translation systems for eukaryotic cell-free protein expression.