Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:Zinc Finger Protein 709
- Antigen Symbol:ZNF709
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100μl
- Gene ID:163051
- Antigen Synonyms:FLJ38281|zinc finger protein 709
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptide directed towards the N terminal of human ZNF709. Peptide sequence DVMQETFVNLASIGENWEEKNIEDHKNQGRKLRSHMVERLCERKEGSQFG.
- Purification:Protein A purified
- Cat. No.:102216-468
- Supplier no.:NBP1-80411
Specifications
About this item
The ZNF709 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF709. This antibody reacts with human. The ZNF709 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: ZNF709
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human