Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:Solute Carrier Family 26 Member A2
- Antigen Symbol:SLC26A2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Mouse
- Western Blot:Yes
- Size:100 μl
- Gene ID:1836
- Antigen Synonyms:sulfate transporter|Solute carrier family 26 member 2|Diastrophic dysplasia protein|member 2|D5S1708|EDM4|DTDMSTP157|DTDSTMST153|solute carrier family 26 (sulfate transporter)|diastrophic dysplasia sulfate transporter|sulfate anion transporter 1
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptide directed towards the C terminal of human Slc26a2. Peptide sequence VSMQLSHDPLEVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLA.
- Purification:Immunogen affinity purified
- Cat. No.:102216-690
- Supplier no.:NBP1-80522
Specifications
About this item
The SLC26A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC26A2. This antibody reacts with mouse. The SLC26A2 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: SLC26A2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse