Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:Solute Carrier Family 26 Member A1
- Antigen Symbol:SLC26A1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:10861
- Antigen Synonyms:sulfate anion tranporter AT1|sulfate transporter|SAT1|EDM4|member 1|sulfate/anion transporter SAT-1 protein|solute carrier family 26 (sulfate transporter)|SAT-1sulfate anion transporter 1|Solute carrier family 26 member 1
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to SLC26A1(solute carrier family 26 (sulfate transporter), member 1) The peptide sequence was selected from the C terminal of SLC26A1. Peptide sequence LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA.
- Purification:Immunogen affinity purified
- Cat. No.:102192-508
- Supplier no.:NBP1-59408
Specifications
About this item
The SLC26A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC26A1. This antibody reacts with human. The SLC26A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: SLC26A1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human