Order Entry
United States
ContactUsLinkComponent
Anti-Prostate Secretory Protein/PSP Rabbit Polyclonal Antibody
Anti-Prostate Secretory Protein/PSP Rabbit Polyclonal Antibody
Catalog # 102223-226
Supplier:  Novus Biologicals
Anti-Prostate Secretory Protein/PSP Rabbit Polyclonal Antibody
Catalog # 102223-226
Supplier:  Novus Biologicals
Supplier Number:  NBP1-98455
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Antibody Type:
    Primary
  • Antigen Name:
    Prostate Secretory Protein/PSP
  • Antigen Symbol:
    PSP
  • Clonality:
    Polyclonal
  • Conjugation:
    Unconjugated
  • Host:
    Rabbit
  • Isotype:
    IgG
  • Reactivity:
    Human
  • Western Blot:
    Yes
  • Size:
    100 μl
  • Environmentally Preferable:
  • Gene ID:
    4477
  • Antigen Synonyms:
    PN44Prostate secretory protein of 94 amino acids|PSP|PRPS|MSP|PRSP|beta-microseminoprotein|immunoglobulin binding factor|MSPB|Immunoglobulin-binding factor|PSP57|microseminoprotein|PSP-94Seminal plasma beta-inhibin|prostatic secretory protein 94|beta-|PSP94HPC13|IGBFProstate secreted seminal plasma protein
  • Storage Buffer:
    PBS and 2% Sucrose
  • Storage Temperature:
    Store at -20C. Avoid freeze-thaw cycles.
  • Immunogen:
    The immunogen for this antibody is Prostate Secretory Protein/PSP. Peptide sequence ETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWI.
  • Purification:
    Immunogen affinity purified
  • Cat. No.:
    102223-226
  • Supplier no.:
    NBP1-98455

Specifications

About this item

The Prostate Secretory Protein / PSP Antibody from Novus Biologicals is a rabbit polyclonal antibody to Prostate Secretory Protein / PSP. This antibody reacts with human. The Prostate Secretory Protein / PSP Antibody has been validated for the following applications: Western Blot.

Type: Primary
Antigen: Prostate Secretory Protein/PSP
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human