Anti-PLUNC Rabbit Polyclonal Antibody
- Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.
- Return Policy
Product Details & Documents
The PLUNC Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLUNC. This antibody reacts with human. The PLUNC Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: PLUNC
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human
Specifications
- Size:100 μl
- Clonality:Polyclonal
- Purification:Immunogen affinity purified
- Storage Buffer:From PBS.
- Isotype:IgG
- Host:Rabbit
- Cat. No.:102191-674
- Reactivity:Human
- Western Blot:Yes
- Antibody Type:Primary
- Antigen Symbol:PLUNC
- Gene ID:51297
- Immunogen:Synthetic peptides corresponding to PLUNC(palate, lung and nasal epithelium carcinoma associated) The peptide sequence was selected from the middle region of PLUNC (NP_057667). Peptide sequence GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL.
- ImmunoChemistry:Yes
- Conjugation:Unconjugated
- Antigen Synonyms:tracheal epithelium enriched protein|Nasopharyngeal carcinoma-related protein|SPLUNC1SPURT|Von Ebner protein Hl|Secretory protein in upper respiratory tracts|ligand-binding protein RYA3|Tracheal epithelium-enriched protein|Lung-specific protein X|protein Plunc|LPLUNC3|LUNXNASG|lung and nasal epithelium associated|bA49G10.5|Palate lung and nasal epithelium clone protein|lung and nasal epithelium carcinoma associated|palate
- Antigen Name:Palate, Lung, And Nasal Epithelium Clone
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.