Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:Peroxisomal Biogenesis Factor 26
- Antigen Symbol:PEX26
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:55670
- Antigen Synonyms:peroxisomal biogenesis factor 26|peroxisome biogenesis disorder|FLJ20695|PEX26M1T|complementation group A|peroxin-26|peroxisome assembly protein 26|peroxisome biogenesis factor 26|Pex26pM1T|complementation group 8
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to PEX26(peroxisomal biogenesis factor 26) The peptide sequence was selected from the middle region of PEX26. Peptide sequence ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK.
- Purification:Immunogen affinity purified
- Cat. No.:102185-180
- Supplier no.:NBP1-55115
Specifications
About this item
The PEX26 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PEX26. This antibody reacts with human. The PEX26 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: PEX26
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human