Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:Methionine Adenosyltransferase 2 Beta
- Antigen Symbol:MAT2B
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:27430
- Antigen Synonyms:SDR23E1|DTDP-4-keto-6-deoxy-D-glucose 4-reductase|MATIIbeta|MGC12237|short chain dehydrogenase/reductase family 23E|Methionine adenosyltransferase II beta|methionine adenosyltransferase II|MAT-II|methionine adenosyltransferase 2 subunit beta|beta|member 1|MAT II beta|beta regulatory subunit of methionine adenosyltransferase|TGR|putative protein product of Nbla02999|Nbla02999
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to MAT2B(methionine adenosyltransferase II, beta) The peptide sequence was selected from the N terminal of MAT2B. Peptide sequence KEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAA.
- Purification:Immunogen affinity purified
- Cat. No.:102188-156
- Supplier no.:NBP1-56616
Specifications
About this item
Rabbit Polyclonal MAT2B Antibody. Tested Applications: Western Blot. Tested Reactivity: Human, Mouse, Rat.
Type: Primary
Antigen: MAT2B
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human