Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:Kelch-like 31
- Antigen Symbol:KLHL31
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:401265
- Antigen Synonyms:kelch repeat and BTB domain-containing protein 1|BKLHD6|KBTBD1|kelch-like protein 31|KLHL|BTB and kelch domain-containing protein 6|kelch-like protein KLHL|kelch repeat and BTB (POZ) domain containing 1|bA345L23.2|kelch-like 31 (Drosophila)
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to KLHL31(kelch-like 31 (Drosophila)) The peptide sequence was selected from the C terminal of KLHL31. Peptide sequence TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP.
- Purification:Immunogen affinity purified
- Cat. No.:102199-802
- Supplier no.:NBP1-70594
Specifications
About this item
Rabbit Polyclonal KLHL31 Antibody. Tested Applications: Western Blot, Immunohistochemistry. Tested Reactivity: Human, Mouse, Rat, Canine.
Type: Primary
Antigen: KLHL31
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human