To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Antibody Type:Primary
- Antigen Name:Grainyhead-like 2
- Antigen Symbol:GRHL2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Environmentally Preferable:
- Gene ID:79977
- Antigen Synonyms:deafness|Transcription factor CP2-like 3FLJ11172|DFNA28|Brother of mammalian grainyhead|grainyhead-like protein 2 homolog|BOMMGC149294|autosomal dominant 28|FLJ13782|grainyhead-like 2 (Drosophila)|TFCP2L3MGC149295
- Storage Buffer:PBS & 2% Sucrose.
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptide directed towards the middle region of human GRHL2. Peptide sequence VEKIAKLYKKSKKGILVNMDDNIIEHYSNEDTFILNMESMVEGFKVTLME.
- Purification:Immunogen affinity purified
- Cat. No.:102216-386
- Supplier no.:NBP1-80369
Rabbit Polyclonal GRHL2 Antibody. Tested Applications: Western Blot. Tested Reactivity: Human, Mouse, Rat, Bovine, Canine, Chicken, Xenopus, Zebrafish.
Type: Primary
Antigen: GRHL2
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human