Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Antibody Type:Primary
- Antigen Symbol:DORFIN
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:25897
- Antigen Synonyms:ring finger protein 19|EC 6.3.2.-|DKFZp566B1346|RNF19|Double ring-finger protein|ring finger protein 19Ap38 protein|protein p38 interacting with transcription factor Sp1|ring-IBR-ring domain containing protein Dorfin|p38|dorfin|E3 ubiquitin-protein ligase RNF19A|EC 6.3.2|RING finger protein 19 isoform
- Storage Buffer:PBS & 2% Sucrose.
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to RNF19A(ring finger protein 19A) The peptide sequence was selected from the N terminal of RNF19A. Peptide sequence IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD.
- Purification:Immunogen affinity purified
- Cat. No.:102192-428
- Supplier no.:NBP1-59367
The DORFIN Antibody from Novus Biologicals is a rabbit polyclonal antibody to DORFIN. This antibody reacts with human. The DORFIN Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: DORFIN
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human