Anti-DHRS7 Rabbit Polyclonal Antibody
The DHRS7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DHRS7. This antibody reacts with mouse. The DHRS7 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: DHRS7
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse
- Size:100 μl
- Clonality:Polyclonal
- Purification:Immunogen affinity purified
- Storage Buffer:PBS and 2% Sucrose
- Isotype:IgG
- Host:Rabbit
- Cat. No.:102198-174
- Reactivity:Mouse
- Western Blot:Yes
- Antibody Type:Primary
- Antigen Symbol:DHRS7
- Gene ID:51635
- Immunogen:Synthetic peptides corresponding to Dhrs7 (dehydrogenase/reductase (SDR family) member 7) The peptide sequence was selected from the N terminal of Dhrs7. Peptide sequence MVVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNL.
- Conjugation:Unconjugated
- Antigen Synonyms:RETSDR4|dehydrogenase/reductase (SDR family) member 7,2310016E22Rik|EC 1.1|member 1|DHRS7A|Retinal short-chain dehydrogenase/reductase 4|short chain dehydrogenase/reductase family 34C|dehydrogenase/reductase SDR family member 7|SDR34C1|retDSR4
- Antigen Name:Dehydrogenase/reductase (SDR family) Member 7
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.