Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Antibody Type:Primary
- Antigen Name:Archaemetzincin 2
- Antigen Symbol:AMZ2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:51321
- Antigen Synonyms:EC 3.-|Archeobacterial metalloproteinase-like protein 2|archaemetzincins-2|archaelysin family metallopeptidase 2|archaemetzincin-2
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptide directed towards the C terminal of human AMZ2. Peptide sequence ACLMQGSNHLEEADRRPLNLCPICLHKLQCAVGFSIVERYKALVRWIDDE.
- Purification:Immunogen affinity purified
- Cat. No.:102214-890
- Supplier no.:NBP1-79621
The Archaemetzincin 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Archaemetzincin 2. This antibody reacts with human. The Archaemetzincin 2 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: Archaemetzincin 2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human