Specifications
- Pack type:Vial
- Conjugation:Unconjugated
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Human
- Size:50 µg
- Tag sequence:MGSSHHHHHHSSGHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGLVPRGSGSEF
- Storage Conditions:–20 °C
- Endotoxin Content:<1.0 EU per 1 μg (determined by the LAL method)
- Gene ID:6036
- Reconstitution Instructions:Reconstitute in 10 mM PBS (pH 7.4) to a concentration of 0.1 - 1.0 mg/ml. Do not vortex.
- Endotoxin-free:N
- Carrier-Free:Y
- Protease-free:N
- Animal-Free:Y
- Protein Synonyms:Ribonuclease A2
- UniProtKB:P10153
- Protein/Peptide Name:RNASE2
- Purity:95 - 100%
- Molecular Weight:32 kDa
- Sequence:Lys28~Ile161
- Endotoxin Level:Low
- Concentration:0.2 mg/ml
- Formulation:Lyophilized from PBS, pH 7.4 containing 0.01% SKL, 5% trehalose
- Nuclease-free:N
- Shipping Temperature:4 °C
- Tested Applications:Positive control, Immunogen, SDS-PAGE, Western blot.
- Cat. No.:MSPP-RPD169HU1
Specifications
About this item
This is a RNASE2 recombinant protein (prokaryotic), Human is sequencing from Lys28~Ile161 with 95 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.
- High quality, purity, reproducibility and effectiveness
- Offers customized buffers and tag options
- 100% quality and service satisfaction guarantee
Eosinophil-derived neurotoxin is a distinct cationic protein of the eosinophil's large specific granule known primarily for its ability to induce ataxia, paralysis, and central nervous system cellular degeneration in experimental animals (Gordon phenomenon). Rosenberg et al. (1989) isolated a 725-bp cDNA clone for EDN. The open reading frame encodes a 134-amino acid polypeptide with a molecular mass of 15.5 kDa and a 27-residue N-terminal hydrophobic leader sequence. The sequence of the mature polypeptide was identical to that reported for human urinary ribonuclease and to the N-terminal sequence of human liver ribonuclease. Similarities to the ribonucleases of pancreas and angiogenin indicate that EDN belongs to the ribonuclease multigene family. This gene is also symbolized RNS2 for ribonuclease 2.