Specifications
- Pack type:Vial
- Conjugation:Unconjugated
- Protein Function:Cytokine
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Rabbit
- Size:50 µg
- Tag sequence:MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPRGSTAIGMKETAAAKFERQHMDSPDLGTGGGSGIEGRGSMGYRGSEF
- Storage Conditions:–20 °C
- Endotoxin Content:<1.0 EU per 1 μg (determined by the LAL method)
- Gene ID:100338211
- Reconstitution Instructions:Reconstitute in 10 mM PBS (pH 7.4) to a concentration of 0.1 - 1.0 mg/ml. Do not vortex.
- Endotoxin-free:N
- Carrier-Free:Y
- Protease-free:N
- Animal-Free:Y
- Protein Synonyms:Vascular Endothelial Growth Factor C
- UniProtKB:G1TEN0
- Protein/Peptide Name:VEGFC
- Purity:97 - 100%
- Molecular Weight:43 kDa
- Sequence:Ala111~Arg226
- Endotoxin Level:Low
- Concentration:0.2 mg/ml
- Formulation:Lyophilized from PBS, pH 7.4 containing 0.01% SKL, 5% trehalose
- Nuclease-free:N
- Shipping Temperature:4 °C
- Tested Applications:Positive control, Immunogen, SDS-PAGE, Western blot.
- Cat. No.:MSPP-RPA145RB1
Specifications
About this item
This is a VEGFC recombinant protein (prokaryotic), Rabbit is sequencing from Ala111~Arg226 with 97 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.
- High quality, purity, reproducibility and effectiveness
- Offers customized buffers and tag options
- 100% quality and service satisfaction guarantee
VEGF-C has been shown to exhibit angiogenic and lymphangiogenic actions. The VEGF family of growth factors and receptors is involved in the development and growth of the vascular endothelial system. Two of its family members, VEGF-C and VEGF-D, regulate the lymphatic endothelial cells via their receptor VEGFR, thus acting as mitogens for these cells. VEGF-C expression is associated with hematological malignancies. Like VEGF it acts as survival factor on leukemia. Together with the expression of their receptors, VEGF and VEGF-C result in the generation of autocrine loops that may support cancer cell survival and proliferation. Further VEGF-C expression has been shown in gastrointestinal tract malignancies where it correlates with lymphatic invasion, lymphnode metastasis and reduced survival.