Specifications
- Pack type:Vial
- Conjugation:Unconjugated
- Protein Function:Cytokine
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Human
- Size:50 µg
- Tag sequence:MGSSHHHHHHSSGHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGLVPRGSGSEF
- Storage Conditions:–20 °C
- Endotoxin Content:<1.0 EU per 1 μg (determined by the LAL method)
- Gene ID:174
- Reconstitution Instructions:Reconstitute in 10 mM PBS (pH 7.4) to a concentration of 0.1 - 1.0 mg/ml. Do not vortex.
- Endotoxin-free:N
- Carrier-Free:Y
- Protease-free:N
- Animal-Free:Y
- Protein Synonyms:Alpha-Fetoprotein
- UniProtKB:P02771
- Protein/Peptide Name:AFP
- Purity:90 - 100%
- Molecular Weight:75 kDa
- Sequence:Ile31~Ser576
- Endotoxin Level:Low
- Concentration:0.2 mg/ml
- Formulation:Lyophilized from PBS, pH 7.4 containing 0.01% SKL, 5% trehalose
- Nuclease-free:N
- Shipping Temperature:4 °C
- Tested Applications:Positive control, Immunogen, SDS-PAGE, Western blot.
- Cat. No.:MSPP-RPA153HU2
Specifications
About this item
This is a AFP recombinant protein (prokaryotic), Human is sequencing from Ile31~Ser576 with 90 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.
- High quality, purity, reproducibility and effectiveness
- Offers customized buffers and tag options
- 100% quality and service satisfaction guarantee
AFP) is a glycoprotein with a molecular weight of between 65,000 and 70,000 daltons including 4% of carbohydrate. During fetal development, AFP maintains high levels in the serum and drops to very low levels throughout the remainder of life. AFP is elevated in the malignant diseases of hepatocellular, testicular nonseminomatous origin, and occasionally of other entodermal origin. AFP may be slightly elevated or persisted in the patients with large hepatic metastases or viral hepatitis. AFP measurement is widely accepted as tumor marker and for monitoring the therapeutic effectiveness of hepatocellular cancer and nonseminomatous testicular cancer.