- Pack type:Vial
- Conjugation:Unconjugated
- Protein Function:Cytokines and Growth Factors
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Rat
- Size:50 µg
- Tag sequence:MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPRGSTAIGMKETAAAKFERQHMDSPDLGTGGGSGIEGRGSMGYRGSEF
- Storage Conditions:−20 °C
- Endotoxin Content:<1.0 EU per 1 µg (determined by the LAL method)
- Gene ID:293897
- Reconstitution Instructions:Reconstitute in 10 mM PBS (pH 7.4) to a concentration of 0.1 - 1.0 mg/ml. Do not vortex.
- Endotoxin-free:N
- Carrier-Free:Y
- Protease-free:N
- Animal-Free:Y
- Protein Synonyms:Dickkopf Related Protein 1
- UniProtKB:D3Z9J1
- Protein/Peptide Name:DKK1 (prokaryotic)
- Purity:97 - 100%
- Molecular Weight:55 kDa
- Sequence:Val36~Asn260
- Endotoxin Level:Low
- Concentration:0.2 mg/ml
- Formulation:Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose
- Nuclease-free:N
- Shipping Temperature:4 °C
- Tested Applications:Positive control, Immunogen, SDS-PAGE, Western blot.
- Cat. No.:MSPP-RPA741RA1
This is a DKK1 recombinant protein (prokaryotic), Rat is sequencing from Val36~Asn260 with 97 to 100% purity. Lyophilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.
- High quality, purity, reproducibility and effectiveness
- Offers customized buffers and tag options
- 100% quality and service satisfaction guarantee
Dickkopf-related protein 1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. Sequence analysis predicted that the 266-amino acid DKK1 protein contains a 31-amino acid N-terminal signal peptide, 2 clusters of cysteine residues, and a potential C-terminal N-glycosylation site. SDS-PAGE and Western blot analysis demonstrated that DKK1 is expressed as a 35-kD doublet protein, which is larger than the deduced molecular mass of 26 kD.