Recombinant GFP (from E. coli)
Vial, 25 µg
Catalog # 77539-596
Supplier: Creative Biomart
Supplier #: GFP-02
Jump to:
- Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.
- Return Policy
Product Details & Documents
Specifications
Specifications
- Pack type:Vial
- Size:25 µg
- Storage Conditions:4 °C
- Protease-free:No
- Endotoxin Level:Low
- Animal-Free:No
- UniProtKB:P42212
- Purity:>95% by SDS-PAGE
- Carrier-Free:No
- Grade:Ultrapure grade
- Endotoxin Content:<1.0 EU/µg (determined by the LAL method)
- Sequence:SMSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
- Concentration:0.4 mg/ml
- Source:E. coli
- Nuclease-free:No
- Cat. No.:77539-596
- Shipping Temperature:20
- Protein/Peptide Type:Recombinant
- Protein/Peptide Name:GFP
- Conjugation:Unconjugated
- Endotoxin-free:No
Specifications
Recommendations
Recommendations will be personalized based on your shopping preferences only if you have given your consent by enabling "Enhance my Shopping Experience" on the "Personal Info page".
Otherwise, you will receive generic recommendations.