Human Recombinant BAX (from E. coli)
Supplier: Creative Biomart
About this item
2 Options Available Below
- Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.
- Return Policy
Product Details & Documents
Specifications for Product Family
Specifications
Specifications
- Catalog No:
- 77538-720
- 77538-718
- Protein/Peptide Name:
- BAX
- BAX
- Protein Synonyms:
- BCL2-associated X protein
- BCL2-associated X protein
- Protein/Peptide Type:
- Recombinant
- Recombinant
- Species:
- Human
- Human
- Source:
- E. coli
- E. coli
- Conjugation:
- Unconjugated
- Unconjugated
- Sequence:
- MGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHHHHHH
- MGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHHHHHH
- Protease-free:
- No
- No
- Animal-Free:
- No
- No
- Nuclease-free:
- No
- No
- Carrier-Free:
- No
- No
- Endotoxin-free:
- No
- No
- Endotoxin Level:
- Low
- Low
- Endotoxin Content:
- <1.0 EU/µg of the protein as determined by the LAL method
- <1.0 EU/µg of the protein as determined by the LAL method
- UniProtKB:
- Q07812
- Q07812
- Purity:
- >95% as determined by SDS-PAGE
- >95% as determined by SDS-PAGE
- Grade:
- Ultrapure grade
- Ultrapure grade
- Reconstitution Instructions:
- It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 µg/µl. Centrifuge the vial at 4 °C before opening to recover the entire contents.
- It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 µg/µl. Centrifuge the vial at 4 °C before opening to recover the entire contents.
- Storage Conditions:
- 4 °C
- 4 °C
- Shipping Temperature:
- 20
- 20
Specifications
Product Family Options
Product Information
- Pack typeSizeAvailabilityPrice
- Supplier Number: BAX-6976H-10UGItem requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.Specifications:
More
Specifications
Cat. No.77538-720Protein/Peptide NameBAXProtein SynonymsBCL2-associated X proteinProtein/Peptide TypeRecombinantSpeciesHumanSourceE. coliConjugationUnconjugatedSequenceMGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHHHHHHProtease-freeNoAnimal-FreeNoNuclease-freeNoCarrier-FreeNoEndotoxin-freeNoEndotoxin LevelLowEndotoxin Content<1.0 EU/µg of the protein as determined by the LAL methodUniProtKBQ07812Purity>95% as determined by SDS-PAGEGradeUltrapure gradeReconstitution InstructionsIt is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 µg/µl. Centrifuge the vial at 4 °C before opening to recover the entire contents.Storage Conditions4 °CShipping Temperature20 - Supplier Number: BAX-6976H-100UGItem requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.Specifications:
More
Specifications
Cat. No.77538-718Protein/Peptide NameBAXProtein SynonymsBCL2-associated X proteinProtein/Peptide TypeRecombinantSpeciesHumanSourceE. coliConjugationUnconjugatedSequenceMGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHHHHHHProtease-freeNoAnimal-FreeNoNuclease-freeNoCarrier-FreeNoEndotoxin-freeNoEndotoxin LevelLowEndotoxin Content<1.0 EU/µg of the protein as determined by the LAL methodUniProtKBQ07812Purity>95% as determined by SDS-PAGEGradeUltrapure gradeReconstitution InstructionsIt is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 µg/µl. Centrifuge the vial at 4 °C before opening to recover the entire contents.Storage Conditions4 °CShipping Temperature20
Recommendations
Recommendations will be personalized based on your shopping preferences only if you have given your consent by enabling "Enhance my Shopping Experience" on the "Personal Info page".
Otherwise, you will receive generic recommendations.