Human Recombinant ALKBH1 (from Wheat Germ)
Vial, 2 µg
Catalog # 77538-596
Supplier: Creative Biomart
: ALKBH1-474H
Human Recombinant ALKBH1 (from Wheat Germ)
Catalog # 77538-596
Supplier: Creative Biomart
CAS Number:
Jump to:
- Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.
- Return Policy
Product Details & Documents
Specifications
Specifications
- Pack type:Vial
- Size:2 µg
- Storage Conditions:4 °C
- Molecular Weight:68.42 kDa
- Protease-free:No
- Endotoxin Level:Low
- Animal-Free:No
- UniProtKB:Q13686
- Tested Applications:Enzyme-linked immunoabsorbent assay, western blot (Recombinant protein), antibody production, protein array
- Carrier-Free:No
- Grade:Ultrapure grade
- Sequence:MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS
- Source:Wheat germ
- Nuclease-free:No
- Cat. No.:77538-596
- Shipping Temperature:20
- Protein/Peptide Type:Recombinant
- Protein Synonyms:alkB, alkylation repair homolog 1
- Protein/Peptide Name:ALKBH1
- Conjugation:Unconjugated
- Endotoxin-free:No
- Species:Human



