Anti-EZH2 Rabbit Polyclonal Antibody
Rabbit polyclonal antibody to EZH2 for WB, IHC and IP with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC, IP
- Recommended Dilutions: WB: 1:500 to 1:1000, IHC: 1:50 to 1:200, IP: 1:500 to 1:100
Type: Primary
Antigen: EZH2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
- Catalog No:
- 77217-178
- Antigen Symbol:
- EZH2
- Antigen Name:
- Enhancer of zeste 2
- Antigen Synonyms:
- Enhancer of zeste homolog 2 (Drosophila)|enhancer of zeste 2 polycomb repressive complex 2 subunit|Enx1h|ENX1|Enhancer of zeste, Drosophila, homolog 2|Enhancer of zeste homolog 2|ENX-1|Enx 1h|ENX 1
- Antibody Type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q15910
- Isotype:
- IgG
- Western Blot:
- Yes
- ImmunoChemistry:
- Yes
- ImmunoPrecipitation:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 133-252 of human EZH2/KMT6 (NP_001190176.1)
- Sequence:
- YMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQL
- Form:
- Liquid
- Molecular Weight:
- 98 kDa
- Purification:
- Affinity purification.
- Storage Buffer:
- Supplied in Phosphate buffered saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at +4 °C
- Tested Applications:
- IHC
Frequently Bought Together
Clorox® Concentrated Germicidal Bleach
: Janitorial Supplies
VWR® Powder-Free Nitrile Examination Gloves
: VWR International
VWR® Disposable Petri Dishes
: VWR International
PURPLE NITRILE™ and PURPLE NITRILE-XTRA™ Examination Gloves, Kimberly-Clark
: Ansell Healthcare
VWR® High-Performance Centrifuge Tubes with Flat or Plug Caps, PP
: VWR International
VWR® Lab Markers
: VWR International
VWR® Broken Glass Disposal Cartons
: VWR International
VWR® Disposable Serological Pipettes
: VWR International
VWR® Universal Pipette Tips
: VWR International
VWR® Nitrile Examination Gloves, Black
: VWR International
VWR® Microcentrifuge Tubes, PP
: VWR International