Order Entry
United States
ContactUsLinkComponent
Anti-MYLK3 / MLCK Rabbit Polyclonal Antibody
Anti-MYLK3 / MLCK Rabbit Polyclonal Antibody
Supplier:  ANTIBODIES.COM LLC
Certificates
undefined
Anti-MYLK3 / MLCK Rabbit Polyclonal Antibody
Supplier:  ANTIBODIES.COM LLC
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Catalog No:
  • 76850-694
  • Antigen Symbol:
  • MYLK3 / MLCK
  • Antibody Type:
  • Primary
  • Clonality:
  • Polyclonal
  • Conjugation:
  • Unconjugated
  • Reactivity:
  • Human, Mouse
  • Host:
  • Rabbit
  • Gene ID:
  • UniprotID# Q32MK0
  • Isotype:
  • IgG
  • Western Blot:
  • Yes
  • ImmunoChemistry:
  • Yes
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human MYLK3 (NP_872299.2)
  • Sequence:
  • MQQDAAQHGARLEALFRMVAAVDRAIALVGATFQKSKVADFLMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGVQSDAREPGEESQKADVLEGT
  • Form:
  • Liquid
  • Purification:
  • Affinity purification.
  • Storage Buffer:
  • Supplied in Phosphate buffered saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal
  • Storage Temperature:
  • Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
  • Shipping Temperature:
  • Shipped on blue ice at +4 °C
  • Tested Applications:
  • ICC/IF

Specifications

Related Information