Rabbit polyclonal antibody to MICU1 for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:100 to 1:500
Type: Primary
Antigen: MICU1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Catalog No:
- 77220-282
- Antigen Symbol:
- MICU1
- Antigen Name:
- Allergen Hom s 4
- Antigen Synonyms:
- atopy related autoantigen CALC|calcium uptake protein 1, mitochondrial|atopy related autoantigen|ara CALC|CBARA1|Calcium uptake protein 1|calcium binding atopy related autoantigen 1|Calcium-binding atopy-related autoantigen 1|Atopy-related autoantigen CALC
- Antibody Type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q9BPX6
- Isotype:
- IgG
- Western Blot:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 105-255 of human MICU1 (NP_001182447.1).
- Sequence:
- GFRDRKVMEYENRIRAYSTPDKIFRYFATLKVISEPGEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKKISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTS
- Form:
- Liquid
- Molecular Weight:
- 46 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C