Rabbit monoclonal [ARC2558] antibody to ARPC2 for WB, ICC/IF and IP with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, ICC/IF, IP
- Recommended Dilutions: WB: 1:500 to 1:1,000, ICC/IF: 1:50 to 1:200, IP: 1:500 to 1:1,000
Type: Primary
Antigen: ARPC2
Clonality: Monoclonal
Clone: ARC2558
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Catalog No:
- 77219-978
- Antigen Symbol:
- ARPC2
- Antigen Name:
- Actin related protein 2/3 complex subunit 2
- Antigen Synonyms:
- ARC 34|Actin related protein 2/3 complex subunit 2 34kDa|ARP2/3 protein compex subunit 34|ARPC2_HUMAN|ARC34|ARPC 2|Arp2/3 complex 34 kDa subunit|Actin-related protein 2/3 complex subunit 2|ARPC2
- Antibody Type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC2558
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# O15144
- Isotype:
- IgG
- Western Blot:
- Yes
- ImmunoChemistry:
- Yes
- ImmunoPrecipitation:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ARPC2 (O15144).
- Sequence:
- FSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
- Form:
- Liquid
- Molecular Weight:
- 34 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C
- Tested Applications:
- ICC/IF