Order Entry
Puerto Rico
ContactUsLinkComponent
Anti-KMT1B/SUV39H2 Rabbit Monoclonal Antibody [clone: ARC0829]
Anti-KMT1B/SUV39H2 Rabbit Monoclonal Antibody [clone: ARC0829]
Supplier:  ANTIBODIES.COM LLC
Certificates
undefined
Anti-KMT1B/SUV39H2 Rabbit Monoclonal Antibody [clone: ARC0829]
Supplier:  ANTIBODIES.COM LLC
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Catalog No:
  • 77219-498
  • Antigen Symbol:
  • KMT1B / SUV39H2
  • Antigen Name:
  • FLJ23414
  • Antigen Synonyms:
  • Histone-lysine N-methyltransferase SUV39H2|Histone H3-K9 methyltransferase 2|Histone lysine N methyltransferase SUV39H2|H3-K9-HMTase 2|Histone lysine N methyltransferase H3 lysine 9 specific 2|H3 K9 HMTase 2|KMT1B|KMT1B / SUV39H2|Histone H3 K9 methyltransferase 2
  • Antibody Type:
  • Primary
  • Clonality:
  • Monoclonal
  • Conjugation:
  • Unconjugated
  • Clone:
  • ARC0829
  • Reactivity:
  • Human
  • Host:
  • Rabbit
  • Gene ID:
  • UniprotID# Q9H5I1
  • Isotype:
  • IgG
  • Western Blot:
  • Yes
  • Immunogen:
  • A synthetic peptide corresponding to a sequence within amino acids 311-410 of human KMT1B/SUV39H2 (Q9H5I1).
  • Sequence:
  • ESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
  • Form:
  • Liquid
  • Molecular Weight:
  • 47 kDa
  • Purification:
  • Affinity purification
  • Storage Buffer:
  • Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
  • Storage Temperature:
  • Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
  • Shipping Temperature:
  • Shipped on blue ice at 4 °C

Specifications

Related Information