Anti-TRP 7 Rabbit Polyclonal Antibody
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit polyclonal antibody to TRP 7 for WB with samples derived from Human and Mouse.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2,000
Type: Primary
Antigen: TRP 7
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse
Specifications
- Catalog No:
- 77211-082
- Antigen Symbol:
- TRP 7
- Antigen Name:
- Capacitative calcium channel TRPC7
- Antigen Synonyms:
- hTRP7|mTRP7|Likley ortholog of mouse transient receptor potential cation channel subfamily C member 7|KNP3|Putative capacitative calcium channel|cation channel, subfamily C, member 7|transient receptor potential-related channel 7, a novel putative Ca2+ channel protein|Transient receptor protein 7|Short transient receptor potential channel 7
- Antibody Type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q9HCX4
- Isotype:
- IgG
- Western Blot:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 720-780 of human TRPC7 (NP_065122.1).
- Sequence:
- YLIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENLTANNTLSKPTRY
- Form:
- Liquid
- Molecular Weight:
- 110 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze / thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at +4 °C