Rabbit monoclonal [ARC0549] antibody to ATP5A for WB, IHC, ICC/IF and IP with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC, ICC/IF, IP
- Recommended Dilutions: WB: 1:500 to 1:2,000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200, IP: 1:500 to 1:1,000
Type: Primary
Antigen: ATP5A
Clonality: Monoclonal
Clone: ARC0549
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Catalog No:
- 77232-534
- Antigen Symbol:
- ATP5A
- Antigen Name:
- ATP synthase alpha chain, mitochondrial
- Antigen Synonyms:
- ATP synthase subunit alpha mitochondrial|ATP sythase (F1 ATPase) alpha subunit|ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle|ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, 1|Atp5a1|ATP synthase subunit alpha|ATP5A|ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 1, cardiac muscle|ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 2, non-cardiac muscle-like 2
- Antibody Type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC0549
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# P25705
- Isotype:
- IgG
- Western Blot:
- Yes
- ImmunoChemistry:
- Yes
- ImmunoPrecipitation:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATP5A1 (P25705).
- Sequence:
- VPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
- Form:
- Liquid
- Molecular Weight:
- 55 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze / thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at +4 °C
- Tested Applications:
- IHC, ICC/IF